Protein FimG (P08190)
Identification | |||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|
Name: | Protein FimG | ||||||||||
Synonyms: | Not Available | ||||||||||
Gene Name: | fimG | ||||||||||
Enzyme Class: | Not Available | ||||||||||
Biological Properties | |||||||||||
General Function: | cell adhesion | ||||||||||
Specific Function: | Involved in regulation of length and mediation of adhesion of type 1 fimbriae (but not necessary for the production of fimbriae). Involved in the integration of FimH in the fimbriae. | ||||||||||
Cellular Location: | Not Available | ||||||||||
SMPDB Pathways: | Not Available | ||||||||||
KEGG Pathways: | Not Available | ||||||||||
Metabolites: |
| ||||||||||
GO Classification: |
| ||||||||||
Gene Properties | |||||||||||
Blattner: | Not Available | ||||||||||
Gene Orientation | Not Available | ||||||||||
Centisome Percentage: | Not Available | ||||||||||
Left Sequence End | Not Available | ||||||||||
Right Sequence End | Not Available | ||||||||||
Gene Sequence: | >504 atgaaatggtgcaaacgtgggtatgtattggcggcaatattggcgctcgcaagtgcgacg atacaggcagccgatgtcaccatcacggtgaacggtaaggtcgtcgccaaaccgtgtacg gtttccaccaccaatgccacggttgatctcggcgatctttattctttcagtcttatgtct gccggggcggcatcggcctggcatgatgttgcgcttgagttgactaattgtccggtggga acgtcgagggtcactgccagcttcagcggggcagccgacagtaccggatattataaaaac caggggaccgcgcaaaacatccagttagagctacaggatgacagtggcaacacattgaat actggcgcaaccaaaacagttcaggtggatgattcctcacaatcagcgcacttcccgtta caggtcagagcattgacagtaaatggcggagccactcagggaaccattcaggcagtgatt agcatcacctatacctacagctga | ||||||||||
Protein Properties | |||||||||||
Pfam Domain Function: | Not Available | ||||||||||
Protein Residues: | 167 | ||||||||||
Protein Molecular Weight: | 17317 | ||||||||||
Protein Theoretical pI: | Not Available | ||||||||||
PDB File: | 3BFQ | ||||||||||
Signaling Regions: |
| ||||||||||
Transmembrane Regions: | Not Available | ||||||||||
Protein Sequence: | >Protein FimG MKWCKRGYVLAAILALASATIQAADVTITVNGKVVAKPCTVSTTNATVDLGDLYSFSLMS AGAASAWHDVALELTNCPVGTSRVTASFSGAADSTGYYKNQGTAQNIQLELQDDSGNTLN TGATKTVQVDDSSQSAHFPLQVRALTVNGGATQGTIQAVISITYTYS | ||||||||||
References | |||||||||||
External Links: |
| ||||||||||
General Reference: | Not Available |