| Identification |
|---|
| Name: | Antitoxin ChpS |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | chpS |
|---|
| Enzyme Class: | Not Available |
|---|
| Biological Properties |
|---|
| General Function: | transcription, DNA-templated |
|---|
| Specific Function: | Antitoxin component of a type II toxin-antitoxin (TA) module. May be involved in the regulation of cell growth. It acts as a suppressor of the endoribonuclease (inhibitory function) of ChpB protein. Both ChpS and ChpB probably bind to the promoter region of the chpS-chpB operon to autoregulate their synthesis. |
|---|
| Cellular Location: | Not Available |
|---|
| SMPDB Pathways: | Not Available |
|---|
| KEGG Pathways: | Not Available |
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| DNA binding | | positive regulation of cell growth | | regulation of transcription, DNA-templated | | transcription, DNA-templated |
|
|---|
| Gene Properties |
|---|
| Blattner: | Not Available |
|---|
| Gene Orientation | Not Available |
|---|
| Centisome Percentage: | Not Available |
|---|
| Left Sequence End | Not Available |
|---|
| Right Sequence End | Not Available |
|---|
| Gene Sequence: | >252
atgcgtattaccataaaaagatgggggaacagtgcaggtatggtcattcccaatatcgta
atgaaagaacttaacttacagccggggcagagcgtggaggcgcaagtgagcaacaatcaa
ctgattctgacacccatctccaggcgctactcgcttgatgaactgctggcacagtgtgac
atgaacgccgcggaacttagcgagcaggatgtctggggtaaatccacccctgcgggtgac
gaaatatggtaa |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | Not Available |
|---|
| Protein Residues: | 83 |
|---|
| Protein Molecular Weight: | 9271 |
|---|
| Protein Theoretical pI: | Not Available |
|---|
| Signaling Regions: | Not Available |
|---|
| Transmembrane Regions: | Not Available |
|---|
| Protein Sequence: | >Antitoxin ChpS
MRITIKRWGNSAGMVIPNIVMKELNLQPGQSVEAQVSNNQLILTPISRRYSLDELLAQCD
MNAAELSEQDVWGKSTPAGDEIW |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | Not Available |
|---|
