Identification |
---|
Name: | Cell division protein FtsB |
---|
Synonyms: | Not Available |
---|
Gene Name: | ftsB |
---|
Enzyme Class: | Not Available |
---|
Biological Properties |
---|
General Function: | FtsZ-dependent cytokinesis |
---|
Specific Function: | Essential cell division protein. May link together the upstream cell division proteins, which are predominantly cytoplasmic, with the downstream cell division proteins, which are predominantly periplasmic. |
---|
Cellular Location: | Not Available |
---|
SMPDB Pathways: | Not Available |
---|
KEGG Pathways: | Not Available |
---|
Metabolites: | |
---|
GO Classification: | Function |
---|
cell division | cell division site | cell septum | FtsZ-dependent cytokinesis | identical protein binding | integral component of plasma membrane |
|
---|
Gene Properties |
---|
Blattner: | Not Available |
---|
Gene Orientation | Not Available |
---|
Centisome Percentage: | Not Available |
---|
Left Sequence End | Not Available |
---|
Right Sequence End | Not Available |
---|
Gene Sequence: | >312
atgggtaaactaacgctgctgttgctggctattctggtctggctacagtattcgctgtgg
ttcggtaagaacggtatacatgactatacccgcgtcaatgatgatgtggcggcacagcaa
gctacaaacgcgaaacttaaagcgcgaaacgatcaactttttgccgaaattgacgatctc
aatggcggccaggaggcgctcgaagagcgtgcgcgtaatgaactcagcatgaccaggccg
ggcgaaactttttatcgtctggtgcctgacgcgtcgaagcgcgcacagtctgcggggcaa
aacaatcgataa |
---|
Protein Properties |
---|
Pfam Domain Function: | Not Available |
---|
Protein Residues: | 103 |
---|
Protein Molecular Weight: | 11621 |
---|
Protein Theoretical pI: | Not Available |
---|
PDB File: | 4IFF |
Signaling Regions: | Not Available |
---|
Transmembrane Regions: | |
---|
Protein Sequence: | >Cell division protein FtsB
MGKLTLLLLAILVWLQYSLWFGKNGIHDYTRVNDDVAAQQATNAKLKARNDQLFAEIDDL
NGGQEALEERARNELSMTRPGETFYRLVPDASKRAQSAGQNNR |
---|
References |
---|
External Links: | |
---|
General Reference: | Not Available |
---|