Identification |
---|
Name: | Integration host factor subunit alpha |
---|
Synonyms: | Not Available |
---|
Gene Name: | ihfA |
---|
Enzyme Class: | Not Available |
---|
Biological Properties |
---|
General Function: | transcription, DNA-templated |
---|
Specific Function: | One of the 2 subunits of integration host factor (IHF), a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.Plays a crucial role in the lysogenic life cycle of bacteriophage lambda, as it is required not only in the recombination reaction, which inserts lambda DNA into the E.coli chromosome, but also for the synthesis of int and cI repressor, two phage proteins necessary for DNA insertion and repression, respectively. The synthesis of int and cI proteins is regulated indirectly by IHF via translational control of the lambda cII protein.Has an essential role in conjugative DNA transfer (CDT), the unidirectional transfer of ssDNA plasmid from a donor to a recipient cell. It is the central mechanism by which antibiotic resistance and virulence factors are propagated in bacterial populations. Part of the relaxosome, which facilitates a site- and strand-specific cut in the origin of transfer by TraI, at the nic site. Relaxosome formation requires binding of IHF and TraY to the oriT region, which then faciliates binding of TraI. |
---|
Cellular Location: | Not Available |
---|
SMPDB Pathways: | Not Available |
---|
KEGG Pathways: | Not Available |
---|
Metabolites: | |
---|
GO Classification: | Function |
---|
conjugation | cytoplasm | DNA binding | DNA recombination | regulation of transcription, DNA-templated | regulation of translation | transcription, DNA-templated |
|
---|
Gene Properties |
---|
Blattner: | Not Available |
---|
Gene Orientation | Not Available |
---|
Centisome Percentage: | Not Available |
---|
Left Sequence End | Not Available |
---|
Right Sequence End | Not Available |
---|
Gene Sequence: | >300
atggcgcttacaaaagctgaaatgtcagaatatctgtttgataagcttgggcttagcaag
cgggatgccaaagaactggttgaactgtttttcgaagagatccgtcgcgctctggaaaac
ggcgaacaggtgaaactctctggttttggtaacttcgatctgcgtgataagaatcaacgc
ccgggacgtaacccgaaaacgggcgaggatattcccattacagcacggcgcgtggtgacc
ttcagacccgggcagaagttaaaaagccgggtcgaaaacgcttcgcccaaagacgagtaa
|
---|
Protein Properties |
---|
Pfam Domain Function: | Not Available |
---|
Protein Residues: | 99 |
---|
Protein Molecular Weight: | 11353 |
---|
Protein Theoretical pI: | Not Available |
---|
PDB File: | 1IHF |
Signaling Regions: | Not Available |
---|
Transmembrane Regions: | Not Available |
---|
Protein Sequence: | >Integration host factor subunit alpha
MALTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQR
PGRNPKTGEDIPITARRVVTFRPGQKLKSRVENASPKDE |
---|
References |
---|
External Links: | |
---|
General Reference: | Not Available |
---|