| Identification |
|---|
| Name: | Ribosome-binding factor A |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | rbfA |
|---|
| Enzyme Class: | Not Available |
|---|
| Biological Properties |
|---|
| General Function: | response to cold |
|---|
| Specific Function: | Essential for efficient processing of 16S rRNA. Probably part of the 30S subunit prior to or during the final step in the processing of 16S free 30S ribosomal subunits. Could be some accessory protein needed for efficient assembly of the 30S subunit. May interact with the 5'-terminal helix region of 16S rRNA. Has affinity for free ribosomal 30S subunits but not for 70S ribosomes. Overexpression suppresses a cold-sensitive C23U 16S rRNA mutation and rimM deletion mutants. Its function probably overlaps Era. |
|---|
| Cellular Location: | Not Available |
|---|
| SMPDB Pathways: | Not Available |
|---|
| KEGG Pathways: | Not Available |
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| cellular response to DNA damage stimulus | | cytoplasm | | maturation of SSU-rRNA | | response to cold | | ribosomal small subunit binding |
|
|---|
| Gene Properties |
|---|
| Blattner: | Not Available |
|---|
| Gene Orientation | Not Available |
|---|
| Centisome Percentage: | Not Available |
|---|
| Left Sequence End | Not Available |
|---|
| Right Sequence End | Not Available |
|---|
| Gene Sequence: | >402
atggcgaaagaatttggtcgcccgcagcgcgtagcgcaggaaatgcaaaaagagatcgct
ctcatcctgcagcgtgaaattaaagatcctcgcctgggcatgatgaccaccgtttccggt
gtcgaaatgtctcgcgacctggcgtatgccaaagtatatgtgacgttcctcaacgacaaa
gatgaagacgcggttaaagcgggcatcaaagcgttgcaagaagcttctggtttcatccgc
agcctgctggggaaagcgatgcgcctgcgtatcgtgccggaactgaccttcttctacgac
aactctctggttgaagggatgcgcatgtcaaacctggtgaccagcgtggtcaaacatgac
gaagaacgtcgtgttaacccggacgacagcaaggaggactaa |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | Not Available |
|---|
| Protein Residues: | 133 |
|---|
| Protein Molecular Weight: | 15154 |
|---|
| Protein Theoretical pI: | Not Available |
|---|
| PDB File: | 1KKG |
| Signaling Regions: | Not Available |
|---|
| Transmembrane Regions: | Not Available |
|---|
| Protein Sequence: | >Ribosome-binding factor A
MAKEFGRPQRVAQEMQKEIALILQREIKDPRLGMMTTVSGVEMSRDLAYAKVYVTFLNDK
DEDAVKAGIKALQEASGFIRSLLGKAMRLRIVPELTFFYDNSLVEGMRMSNLVTSVVKHD
EERRVNPDDSKED |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | Not Available |
|---|
