| Identification |
|---|
| Name: | 30S ribosomal protein S12 |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | rpsL |
|---|
| Enzyme Class: | Not Available |
|---|
| Biological Properties |
|---|
| General Function: | translation |
|---|
| Specific Function: | With S4 and S5 plays an important role in translational accuracy.Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit (By similarity).Cryo-EM studies suggest that S12 contacts the EF-Tu bound tRNA in the A-site during codon-recognition. This contact is most likely broken as the aminoacyl-tRNA moves into the peptidyl transferase center in the 50S subunit. |
|---|
| Cellular Location: | Not Available |
|---|
| SMPDB Pathways: | Not Available |
|---|
| KEGG Pathways: | |
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| cytosolic small ribosomal subunit | | Group I intron splicing | | misfolded RNA binding | | positive regulation of RNA splicing | | response to antibiotic | | RNA folding | | rRNA binding | | structural constituent of ribosome | | translation | | tRNA binding |
|
|---|
| Gene Properties |
|---|
| Blattner: | Not Available |
|---|
| Gene Orientation | Not Available |
|---|
| Centisome Percentage: | Not Available |
|---|
| Left Sequence End | Not Available |
|---|
| Right Sequence End | Not Available |
|---|
| Gene Sequence: | >375
atggcaacagttaaccagctggtacgcaaaccacgtgctcgcaaagttgcgaaaagcaac
gtgcctgcgctggaagcatgcccgcaaaaacgtggcgtatgtactcgtgtatatactacc
actcctaaaaaaccgaactccgcgctgcgtaaagtatgccgtgttcgtctgactaacggt
ttcgaagtgacttcctacatcggtggtgaaggtcacaacctgcaggagcactccgtgatc
ctgatccgtggcggtcgtgttaaagacctcccgggtgttcgttaccacaccgtacgtggt
gcgcttgactgctccggcgttaaagaccgtaagcaggctcgttccaagtatggcgtgaag
cgtcctaaggcttaa |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | Not Available |
|---|
| Protein Residues: | 124 |
|---|
| Protein Molecular Weight: | 13736 |
|---|
| Protein Theoretical pI: | Not Available |
|---|
| PDB File: | 1M5G |
| Signaling Regions: | Not Available |
|---|
| Transmembrane Regions: | Not Available |
|---|
| Protein Sequence: | >30S ribosomal protein S12
MATVNQLVRKPRARKVAKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTNG
FEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQARSKYGVK
RPKA |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | Not Available |
|---|
