| Identification |
|---|
| Name: | Endoribonuclease YbeY |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | ybeY |
|---|
| Enzyme Class: | Not Available |
|---|
| Biological Properties |
|---|
| General Function: | translation |
|---|
| Specific Function: | Single strand-specific metallo-endoribonuclease involved in late-stage 70S ribosome quality control and in maturation of the 3' terminus of the 16S rRNA. Acts together with the RNase R to eliminate defective 70S ribosomes, but not properly matured 70S ribosomes or individual subunits, by a process mediated specifically by the 30S ribosomal subunit. Involved in the processing of 16S, 23S and 5S rRNAs, with a particularly strong effect on maturation at both the 5'-and 3'-ends of 16S rRNA as well as maturation of the 5'-end of 23S and 5S rRNAs. |
|---|
| Cellular Location: | Not Available |
|---|
| SMPDB Pathways: | Not Available |
|---|
| KEGG Pathways: | Not Available |
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| cytoplasm | | endonucleolytic cleavage involved in rRNA processing | | endoribonuclease activity, producing 3'-phosphomonoesters | | maturation of SSU-rRNA | | metalloendopeptidase activity | | nickel cation binding | | response to heat | | ribosomal small subunit biogenesis | | ribosome biogenesis | | rRNA processing | | transcription antitermination | | translation | | zinc ion binding |
|
|---|
| Gene Properties |
|---|
| Blattner: | Not Available |
|---|
| Gene Orientation | Not Available |
|---|
| Centisome Percentage: | Not Available |
|---|
| Left Sequence End | Not Available |
|---|
| Right Sequence End | Not Available |
|---|
| Gene Sequence: | >468
atgagtcaggtgatcctcgatttacaactggcatgtgaagataattccgggttaccggaa
gagagccagtttcagacatggctgaatgcggtgatcccgcagtttcaggaagaatcggaa
gtgacgattcgcgtggtcgataccgccgaaagccacagtctgaatctgacctatcgcggt
aaggataagccgaccaacgtgctctccttcccgtttgaagtgccgcctggcatggaaatg
tcgctactgggcgatctggttatctgccgtcaggtggttgagaaggaagctcaggagcaa
ggcaaaccactggaggcgcactgggcgcatatggtggtgcacggcagtctgcatttgtta
ggttacgatcacatcgaagatgacgaagcagaagaaatggaagccctcgaaacagagatt
atgcttgctctgggctatgaggatccgtacattgccgagaaagaataa |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | Not Available |
|---|
| Protein Residues: | 155 |
|---|
| Protein Molecular Weight: | 17525 |
|---|
| Protein Theoretical pI: | Not Available |
|---|
| PDB File: | 1XM5 |
| Signaling Regions: | Not Available |
|---|
| Transmembrane Regions: | Not Available |
|---|
| Protein Sequence: | >Endoribonuclease YbeY
MSQVILDLQLACEDNSGLPEESQFQTWLNAVIPQFQEESEVTIRVVDTAESHSLNLTYRG
KDKPTNVLSFPFEVPPGMEMSLLGDLVICRQVVEKEAQEQGKPLEAHWAHMVVHGSLHLL
GYDHIEDDEAEEMEALETEIMLALGYEDPYIAEKE |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | Not Available |
|---|
