Identification |
---|
Name: | Probable Fe(2+)-trafficking protein |
---|
Synonyms: | Not Available |
---|
Gene Name: | yggX |
---|
Enzyme Class: | Not Available |
---|
Biological Properties |
---|
General Function: | cellular response to oxidative stress |
---|
Specific Function: | Could be a mediator in iron transactions between iron acquisition and iron-requiring processes, such as synthesis and/or repair of Fe-S clusters in biosynthetic enzymes. Necessary to maintain high levels of aconitase under oxidative stress. |
---|
Cellular Location: | Not Available |
---|
SMPDB Pathways: | Not Available |
---|
KEGG Pathways: | Not Available |
---|
Metabolites: | |
---|
GO Classification: | Function |
---|
cellular response to oxidative stress | iron ion binding |
|
---|
Gene Properties |
---|
Blattner: | Not Available |
---|
Gene Orientation | Not Available |
---|
Centisome Percentage: | Not Available |
---|
Left Sequence End | Not Available |
---|
Right Sequence End | Not Available |
---|
Gene Sequence: | >276
atgagcagaacgattttttgtactttcctgcaacgtgaagcagaaggtcaggattttcag
ctgtaccccggcgagctgggaaaacgcatctataacgagatctccaaagaagcctgggcg
cagtggcagcacaagcaaaccatgctgattaatgaaaagaaactcaacatgatgaatgcc
gagcaccgcaagctgcttgagcaggagatggtcaacttcctgttcgagggtaaagaggtg
catatcgagggctatacgccggaagataaaaaataa |
---|
Protein Properties |
---|
Pfam Domain Function: | Not Available |
---|
Protein Residues: | 91 |
---|
Protein Molecular Weight: | 10952 |
---|
Protein Theoretical pI: | Not Available |
---|
PDB File: | 1YHD |
Signaling Regions: | Not Available |
---|
Transmembrane Regions: | Not Available |
---|
Protein Sequence: | >Probable Fe(2+)-trafficking protein
MSRTIFCTFLQREAEGQDFQLYPGELGKRIYNEISKEAWAQWQHKQTMLINEKKLNMMNA
EHRKLLEQEMVNFLFEGKEVHIEGYTPEDKK |
---|
References |
---|
External Links: | |
---|
General Reference: | Not Available |
---|