Identification |
---|
Name: | ATP-dependent Clp protease adapter protein ClpS |
---|
Synonyms: | Not Available |
---|
Gene Name: | clpS |
---|
Enzyme Class: | Not Available |
---|
Biological Properties |
---|
General Function: | response to heat |
---|
Specific Function: | Involved in the modulation of the specificity of the ClpAP-mediated ATP-dependent protein degradation. |
---|
Cellular Location: | Not Available |
---|
SMPDB Pathways: | Not Available |
---|
KEGG Pathways: | Not Available |
---|
Metabolites: | |
---|
GO Classification: | Function |
---|
chaperone binding | proteolysis involved in cellular protein catabolic process | response to heat |
|
---|
Gene Properties |
---|
Blattner: | Not Available |
---|
Gene Orientation | Not Available |
---|
Centisome Percentage: | Not Available |
---|
Left Sequence End | Not Available |
---|
Right Sequence End | Not Available |
---|
Gene Sequence: | >321
atgggtaaaacgaacgactggctggactttgatcaactggcggaagaaaaagttcgcgac
gcgctaaaaccgccatctatgtataaagtgatattagtcaatgatgattacactccgatg
gagtttgttattgacgtgttacaaaaattcttttcttatgatgtagaacgtgcaacgcaa
ttgatgctcgctgttcactaccaggggaaggccatttgcggagtctttaccgccgaggtt
gcagaaaccaaagtggcgatggtgaacaagtacgcgagggagaatgagcatccattgctg
tgtacgctagaaaaagcctga |
---|
Protein Properties |
---|
Pfam Domain Function: | Not Available |
---|
Protein Residues: | 106 |
---|
Protein Molecular Weight: | 12178 |
---|
Protein Theoretical pI: | Not Available |
---|
PDB File: | 1LZW |
Signaling Regions: | Not Available |
---|
Transmembrane Regions: | Not Available |
---|
Protein Sequence: | >ATP-dependent Clp protease adapter protein ClpS
MGKTNDWLDFDQLAEEKVRDALKPPSMYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQ
LMLAVHYQGKAICGVFTAEVAETKVAMVNKYARENEHPLLCTLEKA |
---|
References |
---|
External Links: | |
---|
General Reference: | Not Available |
---|