Identification |
---|
Name: | Met repressor |
---|
Synonyms: | Not Available |
---|
Gene Name: | metJ |
---|
Enzyme Class: | Not Available |
---|
Biological Properties |
---|
General Function: | transcription, DNA-templated |
---|
Specific Function: | This regulatory protein, when combined with SAM (S-adenosylmethionine) represses the expression of the methionine regulon and of enzymes involved in SAM synthesis. It is also autoregulated. |
---|
Cellular Location: | Not Available |
---|
SMPDB Pathways: | Not Available |
---|
KEGG Pathways: | Not Available |
---|
Metabolites: | |
---|
GO Classification: | Function |
---|
cytoplasm | DNA binding | methionine biosynthetic process | negative regulation of transcription, DNA-templated | sequence-specific DNA binding transcription factor activity | transcription, DNA-templated |
|
---|
Gene Properties |
---|
Blattner: | Not Available |
---|
Gene Orientation | Not Available |
---|
Centisome Percentage: | Not Available |
---|
Left Sequence End | Not Available |
---|
Right Sequence End | Not Available |
---|
Gene Sequence: | >318
atggctgaatggagcggcgaatatatcagcccatacgctgagcacggcaagaagagtgaa
caagtcaaaaagattacggtttccattcctcttaaggtgttaaaaatcctcaccgatgaa
cgcacgcgtcgtcaggtgaacaacctgcgtcacgctaccaacagcgagctgctgtgcgaa
gcgtttctgcatgcctttaccgggcaacctttgccggatgatgccgatctgcgtaaagag
cgcagcgacgaaatcccggaagcggcaaaagagatcatgcgtgagatggggattaacccg
gagacgtgggaatactaa |
---|
Protein Properties |
---|
Pfam Domain Function: | Not Available |
---|
Protein Residues: | 105 |
---|
Protein Molecular Weight: | 12140 |
---|
Protein Theoretical pI: | Not Available |
---|
PDB File: | 1CMA |
Signaling Regions: | Not Available |
---|
Transmembrane Regions: | Not Available |
---|
Protein Sequence: | >Met repressor
MAEWSGEYISPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRRQVNNLRHATNSELLCE
AFLHAFTGQPLPDDADLRKERSDEIPEAAKEIMREMGINPETWEY |
---|
References |
---|
External Links: | |
---|
General Reference: | Not Available |
---|