Identification |
---|
Name: | Outer membrane protein assembly factor BamE |
---|
Synonyms: | Not Available |
---|
Gene Name: | bamE |
---|
Enzyme Class: | Not Available |
---|
Biological Properties |
---|
General Function: | response to antibiotic |
---|
Specific Function: | Part of the outer membrane protein assembly complex, which is involved in assembly and insertion of beta-barrel proteins into the outer membrane. Nonessential member of the complex that stabilizes the interaction between the essential proteins BamA and BamD. May modulate the conformation of BamA, likely through interactions with BamD. |
---|
Cellular Location: | Not Available |
---|
SMPDB Pathways: | Not Available |
---|
KEGG Pathways: | Not Available |
---|
Metabolites: | |
---|
GO Classification: | Function |
---|
Gram-negative-bacterium-type cell outer membrane assembly | identical protein binding | integral component of cell outer membrane | membrane | protein binding, bridging | protein insertion into membrane | response to antibiotic |
|
---|
Gene Properties |
---|
Blattner: | Not Available |
---|
Gene Orientation | Not Available |
---|
Centisome Percentage: | Not Available |
---|
Left Sequence End | Not Available |
---|
Right Sequence End | Not Available |
---|
Gene Sequence: | >342
atgcgctgtaaaacgctgactgctgcagcagcagtactattgatgttgaccgcaggctgt
tccactctggagcgagtggtttaccgtcctgacatcaaccaggggaactatctgaccgct
aacgacgtatccaaaatacgtgttggcatgacgcaacaacaagttgcgtacgcattgggt
acaccgctgatgtccgatccatttggtacgaatacctggttctatgtcttccgccagcaa
ccaggtcatgaaggtgtaactcagcaaacgctgacgctgacctttaacagtagcggtgtg
ttgaccaatattgataacaaacctgcgctgagtggtaactaa |
---|
Protein Properties |
---|
Pfam Domain Function: | Not Available |
---|
Protein Residues: | 113 |
---|
Protein Molecular Weight: | 12301 |
---|
Protein Theoretical pI: | Not Available |
---|
PDB File: | 2KM7 |
Signaling Regions: | |
---|
Transmembrane Regions: | Not Available |
---|
Protein Sequence: | >Outer membrane protein assembly factor BamE
MRCKTLTAAAAVLLMLTAGCSTLERVVYRPDINQGNYLTANDVSKIRVGMTQQQVAYALG
TPLMSDPFGTNTWFYVFRQQPGHEGVTQQTLTLTFNSSGVLTNIDNKPALSGN |
---|
References |
---|
External Links: | |
---|
General Reference: | Not Available |
---|