| Identification |
|---|
| Name: | Cold shock-like protein CspI |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | cspI |
|---|
| Enzyme Class: | Not Available |
|---|
| Biological Properties |
|---|
| General Function: | transcription, DNA-templated |
|---|
| Specific Function: | Not Available |
|---|
| Cellular Location: | Not Available |
|---|
| SMPDB Pathways: | Not Available |
|---|
| KEGG Pathways: | Not Available |
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| cytoplasm | | DNA binding | | regulation of transcription, DNA-templated | | response to cold | | transcription, DNA-templated |
|
|---|
| Gene Properties |
|---|
| Blattner: | Not Available |
|---|
| Gene Orientation | Not Available |
|---|
| Centisome Percentage: | Not Available |
|---|
| Left Sequence End | Not Available |
|---|
| Right Sequence End | Not Available |
|---|
| Gene Sequence: | >213
atgtctaacaaaatgactggtttagtgaaatggtttaaccctgaaaaaggttttggtttc
atcacgccgaaagatggcagcaaagatgtgtttgtccatttctcagcaattcagagcaac
gatttcaaaacattaactgagaatcaggaagttgaatttggtattgagaacggacctaaa
ggtcctgccgctgttcatgtagtggcgctttga |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | Not Available |
|---|
| Protein Residues: | 70 |
|---|
| Protein Molecular Weight: | 7683 |
|---|
| Protein Theoretical pI: | Not Available |
|---|
| Signaling Regions: | Not Available |
|---|
| Transmembrane Regions: | Not Available |
|---|
| Protein Sequence: | >Cold shock-like protein CspI
MSNKMTGLVKWFNPEKGFGFITPKDGSKDVFVHFSAIQSNDFKTLTENQEVEFGIENGPK
GPAAVHVVAL |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | Not Available |
|---|
