Identification |
---|
Name: | 2Fe-2S ferredoxin |
---|
Synonyms: | Not Available |
---|
Gene Name: | fdx |
---|
Enzyme Class: | Not Available |
---|
Biological Properties |
---|
General Function: | oxidation-reduction process |
---|
Specific Function: | Ferredoxin are iron-sulfur proteins that transfer electrons in a wide variety of metabolic reactions. Although the function of this ferredoxin is unknown it is probable that it has a role as a cellular electron transfer protein. Involved in the in vivo assembly of the Fe-S clusters in a wide variety of iron-sulfur proteins. |
---|
Cellular Location: | Not Available |
---|
SMPDB Pathways: | Not Available |
---|
KEGG Pathways: | Not Available |
---|
Metabolites: | |
---|
GO Classification: | Function |
---|
2 iron, 2 sulfur cluster binding | electron carrier activity | iron-sulfur cluster assembly | metal ion binding | oxidation-reduction process |
|
---|
Gene Properties |
---|
Blattner: | Not Available |
---|
Gene Orientation | Not Available |
---|
Centisome Percentage: | Not Available |
---|
Left Sequence End | Not Available |
---|
Right Sequence End | Not Available |
---|
Gene Sequence: | >336
atgccaaagattgttattttgcctcatcaggatctctgccctgatggcgctgttctggaa
gctaatagcggtgaaaccattctcgacgcagctctgcgtaacggtatcgagattgaacac
gcctgtgaaaaatcctgtgcttgcaccacctgccactgcatcgttcgtgaaggttttgac
tcactgccggaaagctcagagcaggaagacgacatgctggacaaagcctggggactggag
ccggaaagccgtttaagctgccaggcgcgcgttaccgacgaagatttagtagtcgaaatc
ccgcgttacactatcaaccatgcgcgtgagcattaa |
---|
Protein Properties |
---|
Pfam Domain Function: | Not Available |
---|
Protein Residues: | 111 |
---|
Protein Molecular Weight: | 12330 |
---|
Protein Theoretical pI: | Not Available |
---|
PDB File: | 1I7H |
Signaling Regions: | Not Available |
---|
Transmembrane Regions: | Not Available |
---|
Protein Sequence: | >2Fe-2S ferredoxin
MPKIVILPHQDLCPDGAVLEANSGETILDAALRNGIEIEHACEKSCACTTCHCIVREGFD
SLPESSEQEDDMLDKAWGLEPESRLSCQARVTDEDLVVEIPRYTINHAREH |
---|
References |
---|
External Links: | |
---|
General Reference: | Not Available |
---|