Identification |
---|
Name: | Cold shock protein CspA |
---|
Synonyms: | Not Available |
---|
Gene Name: | cspA |
---|
Enzyme Class: | Not Available |
---|
Biological Properties |
---|
General Function: | transcription, DNA-templated |
---|
Specific Function: | Binds to and stimulates the transcription of the CCAAT-containing, cold-shock-inducible promoters of the H-NS and GyrA proteins. Binds also to the inverted repeat 5'-ATTGG-3'. |
---|
Cellular Location: | Not Available |
---|
SMPDB Pathways: | Not Available |
---|
KEGG Pathways: | Not Available |
---|
Metabolites: | |
---|
GO Classification: | Function |
---|
cytoplasm | DNA binding | negative regulation of DNA-templated transcription, termination | response to cold | RNA binding | RNA binding transcription antitermination factor activity | single-stranded DNA binding | single-stranded RNA binding | transcription antitermination | transcription, DNA-templated |
|
---|
Gene Properties |
---|
Blattner: | Not Available |
---|
Gene Orientation | Not Available |
---|
Centisome Percentage: | Not Available |
---|
Left Sequence End | Not Available |
---|
Right Sequence End | Not Available |
---|
Gene Sequence: | >213
atgtccggtaaaatgactggtatcgtaaaatggttcaacgctgacaaaggcttcggcttc
atcactcctgacgatggctctaaagatgtgttcgtacacttctctgctatccagaacgat
ggttacaaatctctggacgaaggtcagaaagtgtccttcaccatcgaaagcggcgctaaa
ggcccggcagctggtaacgtaaccagcctgtaa |
---|
Protein Properties |
---|
Pfam Domain Function: | Not Available |
---|
Protein Residues: | 70 |
---|
Protein Molecular Weight: | 7403 |
---|
Protein Theoretical pI: | Not Available |
---|
PDB File: | 1MJC |
Signaling Regions: | Not Available |
---|
Transmembrane Regions: | Not Available |
---|
Protein Sequence: | >Cold shock protein CspA
MSGKMTGIVKWFNADKGFGFITPDDGSKDVFVHFSAIQNDGYKSLDEGQKVSFTIESGAK
GPAAGNVTSL |
---|
References |
---|
External Links: | |
---|
General Reference: | Not Available |
---|