Iron-binding protein iscA (P0AAC8)

Identification
Name:Iron-binding protein iscA
Synonyms:
  • Iron-sulfur cluster assembly protein
Gene Name:iscA
Enzyme Class:Not Available
Biological Properties
General Function:Involved in structural molecule activity
Specific Function:Is able to transfer iron-sulfur clusters to apo- ferredoxin. Multiple cycles of [2Fe2S] cluster formation and transfer are observed, suggesting that iscA acts catalytically. Recruits intracellular free iron so as to provide iron for the assembly of transient iron-sulfur cluster in iscU in the presence of iscS, L-cysteine and the thioredoxin reductase system trxA/trxB
Cellular Location:Not Available
SMPDB Pathways:Not Available
KEGG Pathways:Not Available
Complex Reactions:
4.0Thumb+1.0IscU with bound [2Fe-2S] cluster → 1.0[2Fe-2S] iron-sulfur cluster+1.0IscU scaffold protein
4.0Hydrogen ion + 1.0IscU with bound [2Fe-2S] cluster → 1.0[2Fe-2S] iron-sulfur cluster + 1.0IscU scaffold protein
ReactionCard
4.0Thumb+1.0IscU with bound [4Fe-4S] cluster → 1.0[4Fe-4S] iron-sulfur cluster+1.0IscU scaffold protein
4.0Hydrogen ion + 1.0IscU with bound [4Fe-4S] cluster → 1.0[4Fe-4S] iron-sulfur cluster + 1.0IscU scaffold protein
ReactionCard
Metabolites:
ECMDB IDNameView
ECMDB21225Hydrogen ionMetaboCard
GO Classification:
Function
binding
cation binding
ion binding
iron ion binding
iron-sulfur cluster binding
metal cluster binding
metal ion binding
protein binding
structural molecule activity
transition metal ion binding
Process
biosynthetic process
cellular biosynthetic process
cofactor biosynthetic process
iron-sulfur cluster assembly
metabolic process
metallo-sulfur cluster assembly
Gene Properties
Blattner:b2528
Gene OrientationCounterclockwise
Centisome Percentage:57.28
Left Sequence End2657585
Right Sequence End2657908
Gene Sequence:
>324 bp
ATGCAATTTTCTACAACCCCAACTCTGGAAGGCCAGACCATCGTTGAATATTGCGGTGTG
GTGACCGGCGAAGCGATTTTAGGTGCCAATATTTTCCGTGATTTCTTTGCCGGTATCCGC
GATATCGTTGGCGGACGTTCCGGTGCGTATGAAAAAGAACTGCGTAAAGCACGGGAGATC
GCCTTTGAGGAATTAGGCTCCCAGGCGCGGGCGCTGGGGGCCGATGCCGTCGTCGGTATT
GATATCGACTACGAAACGGTCGGGCAAAACGGCAGTATGCTGATGGTTAGCGTCAGCGGT
ACGGCGGTGAAAACGCGTCGATGA
Protein Properties
Pfam Domain Function:
Protein Residues:107
Protein Molecular Weight:11556
Protein Theoretical pI:5
PDB File:1S98
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Iron-binding protein iscA
MSITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTPEDIVFEDKGV
KVVVDGKSLQFLDGTQLDFVKEGLNEGFKFTNPNVKDECGCGESFHV
References
External Links:
ResourceLink
Uniprot ID:P0AAC8
Uniprot Name:ISCA_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:4062446
PDB ID:1S98
Ecogene ID:EG12132
Ecocyc:EG12132
ColiBase:b2528
Kegg Gene:b2528
EchoBASE ID:EB2053
CCDB:ISCA_ECOLI
BacMap:16130453
General Reference:
  • Bilder, P. W., Ding, H., Newcomer, M. E. (2004). "Crystal structure of the ancient, Fe-S scaffold IscA reveals a novel protein fold." Biochemistry 43:133-139. Pubmed: 14705938
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Bonomi, F., Iametti, S., Ta, D., Vickery, L. E. (2005). "Multiple turnover transfer of [2Fe2S] clusters by the iron-sulfur cluster assembly scaffold proteins IscU and IscA." J Biol Chem 280:29513-29518. Pubmed: 15964837
  • Cupp-Vickery, J. R., Silberg, J. J., Ta, D. T., Vickery, L. E. (2004). "Crystal structure of IscA, an iron-sulfur cluster assembly protein from Escherichia coli." J Mol Biol 338:127-137. Pubmed: 15050828
  • Ding, H., Clark, R. J. (2004). "Characterization of iron binding in IscA, an ancient iron-sulphur cluster assembly protein." Biochem J 379:433-440. Pubmed: 14720122
  • Ding, H., Clark, R. J., Ding, B. (2004). "IscA mediates iron delivery for assembly of iron-sulfur clusters in IscU under the limited accessible free iron conditions." J Biol Chem 279:37499-37504. Pubmed: 15247288
  • Ding, H., Harrison, K., Lu, J. (2005). "Thioredoxin reductase system mediates iron binding in IscA and iron delivery for the iron-sulfur cluster assembly in IscU." J Biol Chem 280:30432-30437. Pubmed: 15985427
  • Fountoulakis, M., Takacs, M. F., Berndt, P., Langen, H., Takacs, B. (1999). "Enrichment of low abundance proteins of Escherichia coli by hydroxyapatite chromatography." Electrophoresis 20:2181-2195. Pubmed: 10493123
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Kawula, T. H., Lelivelt, M. J. (1994). "Mutations in a gene encoding a new Hsp70 suppress rapid DNA inversion and bgl activation, but not proU derepression, in hns-1 mutant Escherichia coli." J Bacteriol 176:610-619. Pubmed: 8300516
  • Ollagnier-de-Choudens, S., Mattioli, T., Takahashi, Y., Fontecave, M. (2001). "Iron-sulfur cluster assembly: characterization of IscA and evidence for a specific and functional complex with ferredoxin." J Biol Chem 276:22604-22607. Pubmed: 11319236
  • Yamamoto, Y., Aiba, H., Baba, T., Hayashi, K., Inada, T., Isono, K., Itoh, T., Kimura, S., Kitagawa, M., Makino, K., Miki, T., Mitsuhashi, N., Mizobuchi, K., Mori, H., Nakade, S., Nakamura, Y., Nashimoto, H., Oshima, T., Oyama, S., Saito, N., Sampei, G., Satoh, Y., Sivasundaram, S., Tagami, H., Horiuchi, T., et, a. l. .. (1997). "Construction of a contiguous 874-kb sequence of the Escherichia coli -K12 genome corresponding to 50.0-68.8 min on the linkage map and analysis of its sequence features." DNA Res 4:91-113. Pubmed: 9205837