| Identification |
|---|
| Name: | Hydrogenase isoenzymes formation protein HypC |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | hypC |
|---|
| Enzyme Class: | Not Available |
|---|
| Biological Properties |
|---|
| General Function: | protein maturation |
|---|
| Specific Function: | Is required for the formation of all three hydrogenase isoenzymes. May bind to the precursor form of the large subunit of dehydrogenases to keep them in a conformation accessible for metal incorporation. |
|---|
| Cellular Location: | Not Available |
|---|
| SMPDB Pathways: | Not Available |
|---|
| KEGG Pathways: | Not Available |
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| carbon dioxide binding | | identical protein binding | | iron ion binding | | protein maturation |
|
|---|
| Gene Properties |
|---|
| Blattner: | Not Available |
|---|
| Gene Orientation | Not Available |
|---|
| Centisome Percentage: | Not Available |
|---|
| Left Sequence End | Not Available |
|---|
| Right Sequence End | Not Available |
|---|
| Gene Sequence: | >273
atgtgcataggcgttcccggccagatccgcaccattgacggcaaccaggcgaaagtcgac
gtctgcggcattcagcgcgatgtcgatttaacgttagtcggcagctgcgatgaaaacggt
cagccgcgcgtgggccagtgggtactggtacacgttggctttgccatgagcgtaattaat
gaagccgaagcacgcgacactctcgacgccttacaaaacatgtttgacgttgagccggat
gtcggcgcgctgttgtatggcgaggaaaaataa |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | Not Available |
|---|
| Protein Residues: | 90 |
|---|
| Protein Molecular Weight: | 9731 |
|---|
| Protein Theoretical pI: | Not Available |
|---|
| PDB File: | 2OT2 |
| Signaling Regions: | Not Available |
|---|
| Transmembrane Regions: | Not Available |
|---|
| Protein Sequence: | >Hydrogenase isoenzymes formation protein HypC
MCIGVPGQIRTIDGNQAKVDVCGIQRDVDLTLVGSCDENGQPRVGQWVLVHVGFAMSVIN
EAEARDTLDALQNMFDVEPDVGALLYGEEK |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | Not Available |
|---|
