Identification |
---|
Name: | Hydrogenase-2 operon protein HybG |
---|
Synonyms: | Not Available |
---|
Gene Name: | hybG |
---|
Enzyme Class: | Not Available |
---|
Biological Properties |
---|
General Function: | chaperone-mediated protein complex assembly |
---|
Specific Function: | May have a specific role in the maturation of the large subunits of HYD1 and HYD2. |
---|
Cellular Location: | Not Available |
---|
SMPDB Pathways: | Not Available |
---|
KEGG Pathways: | Not Available |
---|
Metabolites: | |
---|
GO Classification: | Function |
---|
chaperone-mediated protein complex assembly |
|
---|
Gene Properties |
---|
Blattner: | Not Available |
---|
Gene Orientation | Not Available |
---|
Centisome Percentage: | Not Available |
---|
Left Sequence End | Not Available |
---|
Right Sequence End | Not Available |
---|
Gene Sequence: | >249
atgtgtattggcgttccaggccaggtgctggctgtcggtgaagatattcaccagcttgcg
caggttgaagtatgtggtatcaagcgcgatgtgaatatcgccctgatttgtgaaggtaac
cctgccgatctactgggccagtgggtgctggtacacgtcggatttgccatgagcatcatc
gacgaagatgaagccaaagccacattagacgcactgcgccaaatggattacgacattacc
agcgcgtga |
---|
Protein Properties |
---|
Pfam Domain Function: | Not Available |
---|
Protein Residues: | 82 |
---|
Protein Molecular Weight: | 8808 |
---|
Protein Theoretical pI: | Not Available |
---|
Signaling Regions: | Not Available |
---|
Transmembrane Regions: | Not Available |
---|
Protein Sequence: | >Hydrogenase-2 operon protein HybG
MCIGVPGQVLAVGEDIHQLAQVEVCGIKRDVNIALICEGNPADLLGQWVLVHVGFAMSII
DEDEAKATLDALRQMDYDITSA |
---|
References |
---|
External Links: | |
---|
General Reference: | Not Available |
---|