Identification |
---|
Name: | Anti-adapter protein IraP |
---|
Synonyms: | Not Available |
---|
Gene Name: | iraP |
---|
Enzyme Class: | Not Available |
---|
Biological Properties |
---|
General Function: | positive regulation of transcription, DNA-templated |
---|
Specific Function: | Inhibits RpoS proteolysis by regulating RssB activity, thereby increasing the stability of the sigma stress factor RpoS especially during phosphate starvation, but also in stationary phase and during nitrogen starvation. Its effect on RpoS stability is due to its interaction with RssB, which probably blocks the interaction of RssB with RpoS, and the consequent delivery of the RssB-RpoS complex to the ClpXP protein degradation pathway. |
---|
Cellular Location: | Not Available |
---|
SMPDB Pathways: | Not Available |
---|
KEGG Pathways: | Not Available |
---|
Metabolites: | |
---|
GO Classification: | Function |
---|
anti-sigma factor antagonist activity | cellular response to phosphate starvation | cytoplasm | negative regulation of protein catabolic process | positive regulation of transcription, DNA-templated |
|
---|
Gene Properties |
---|
Blattner: | Not Available |
---|
Gene Orientation | Not Available |
---|
Centisome Percentage: | Not Available |
---|
Left Sequence End | Not Available |
---|
Right Sequence End | Not Available |
---|
Gene Sequence: | >261
atgaaaaatctcattgctgagttgttatttaagcttgcccaaaaagaagaagagtcgaaa
gaactgtgtgcgcaggtagaagctttggagattatcgtcactgcaatgcttcgcaatatg
gcgcaaaatgaccaacagcggttgattgatcaggtagagggggcgctgtacgaggtaaag
cccgatgccagcattcctgacgacgatacggagctgctgcgcgattacgtaaagaagtta
ttgaagcatcctcgtcagtaa |
---|
Protein Properties |
---|
Pfam Domain Function: | Not Available |
---|
Protein Residues: | 86 |
---|
Protein Molecular Weight: | 9937 |
---|
Protein Theoretical pI: | Not Available |
---|
Signaling Regions: | Not Available |
---|
Transmembrane Regions: | Not Available |
---|
Protein Sequence: | >Anti-adapter protein IraP
MKNLIAELLFKLAQKEEESKELCAQVEALEIIVTAMLRNMAQNDQQRLIDQVEGALYEVK
PDASIPDDDTELLRDYVKKLLKHPRQ |
---|
References |
---|
External Links: | |
---|
General Reference: | Not Available |
---|