Identification |
---|
Name: | Ribosomal silencing factor RsfS |
---|
Synonyms: | Not Available |
---|
Gene Name: | rsfS |
---|
Enzyme Class: | Not Available |
---|
Biological Properties |
---|
General Function: | negative regulation of translation |
---|
Specific Function: | Functions as a ribosomal silencing factor. Addition to isolated ribosomal subunits partially inhibits their association, preventing translation. Interacts with ribosomal protein L14 (rplN), blocking formation of intersubunit bridge B8, preventing association of the 30S and 50S ribosomal subunits and the formation of functional ribosomes, thus repressing translation. |
---|
Cellular Location: | Not Available |
---|
SMPDB Pathways: | Not Available |
---|
KEGG Pathways: | Not Available |
---|
Metabolites: | |
---|
GO Classification: | Function |
---|
cytoplasm | mature ribosome assembly | negative regulation of ribosome biogenesis | negative regulation of translation | ribosomal large subunit binding |
|
---|
Gene Properties |
---|
Blattner: | Not Available |
---|
Gene Orientation | Not Available |
---|
Centisome Percentage: | Not Available |
---|
Left Sequence End | Not Available |
---|
Right Sequence End | Not Available |
---|
Gene Sequence: | >318
ttgcagggtaaagcactccaggattttgttatcgacaaaattgatgacctcaaaggtcag
gacatcatcgccttagacgttcagggcaaatccagcatcaccgactgcatgatcatctgt
acgggtacgtccagccgtcatgttatgtccattgctgaccacgttgtgcaggagtctcgc
gcagcgggcctgttaccgctcggcgtagaaggtgaaaacagcgccgactggattgtcgtg
gatttgggcgatgtgattgtccatgtcatgcaggaagagagccgtcgcctgtatgaactg
gaaaaactctggagttaa |
---|
Protein Properties |
---|
Pfam Domain Function: | Not Available |
---|
Protein Residues: | 105 |
---|
Protein Molecular Weight: | 11582 |
---|
Protein Theoretical pI: | Not Available |
---|
Signaling Regions: | Not Available |
---|
Transmembrane Regions: | Not Available |
---|
Protein Sequence: | >Ribosomal silencing factor RsfS
MQGKALQDFVIDKIDDLKGQDIIALDVQGKSSITDCMIICTGTSSRHVMSIADHVVQESR
AAGLLPLGVEGENSADWIVVDLGDVIVHVMQEESRRLYELEKLWS |
---|
References |
---|
External Links: | |
---|
General Reference: | Not Available |
---|