| Identification |
|---|
| Name: | Multidrug efflux pump accessory protein AcrZ |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | acrZ |
|---|
| Enzyme Class: | Not Available |
|---|
| Biological Properties |
|---|
| General Function: | response to antibiotic |
|---|
| Specific Function: | AcrA-AcrB-AcrZ-TolC is a drug efflux protein complex with a broad substrate specificity. This protein binds to AcrB and is required for efflux of some but not all substrates, suggesting it may influence the specificity of drug export. |
|---|
| Cellular Location: | Not Available |
|---|
| SMPDB Pathways: | Not Available |
|---|
| KEGG Pathways: | Not Available |
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| cell outer membrane | | cellular response to cell envelope stress | | drug transmembrane transporter activity | | integral component of membrane | | plasma membrane | | response to antibiotic |
|
|---|
| Gene Properties |
|---|
| Blattner: | Not Available |
|---|
| Gene Orientation | Not Available |
|---|
| Centisome Percentage: | Not Available |
|---|
| Left Sequence End | Not Available |
|---|
| Right Sequence End | Not Available |
|---|
| Gene Sequence: | >150
atgttagagttattaaaaagtctggtattcgccgtaatcatggtacctgtcgtgatggcc
atcatcctgggtctgatttacggtcttggtgaagtattcaacatcttttctggtgttggt
aaaaaagaccagcccggacaaaatcattga |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | Not Available |
|---|
| Protein Residues: | 49 |
|---|
| Protein Molecular Weight: | 5300 |
|---|
| Protein Theoretical pI: | Not Available |
|---|
| PDB File: | 4C48 |
| Signaling Regions: | Not Available |
|---|
| Transmembrane Regions: | |
|---|
| Protein Sequence: | >Multidrug efflux pump accessory protein AcrZ
MLELLKSLVFAVIMVPVVMAIILGLIYGLGEVFNIFSGVGKKDQPGQNH |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | Not Available |
|---|
