| Identification |
|---|
| Name: | Biofilm regulator BssS |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | bssS |
|---|
| Enzyme Class: | Not Available |
|---|
| Biological Properties |
|---|
| General Function: | regulation of single-species biofilm formation |
|---|
| Specific Function: | Represses biofilm formation in M9C glu and LB glu media but not in M9C and LB media. Seems to act as a global regulator of several genes involved in catabolite repression and stress response and regulation of the uptake and export of signaling pathways. Could be involved the regulation of indole as well as uptake and export of AI-2 through a cAMP-dependent pathway. |
|---|
| Cellular Location: | Not Available |
|---|
| SMPDB Pathways: | Not Available |
|---|
| KEGG Pathways: | Not Available |
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| regulation of single-species biofilm formation |
|
|---|
| Gene Properties |
|---|
| Blattner: | Not Available |
|---|
| Gene Orientation | Not Available |
|---|
| Centisome Percentage: | Not Available |
|---|
| Left Sequence End | Not Available |
|---|
| Right Sequence End | Not Available |
|---|
| Gene Sequence: | >255
atggaaaaaaataatgaagtcattcagactcatccgctcgtagggtgggacatcagcacc
gttgatagctatgatgcgctgatgttgcgtttgcactaccagaccccaaataagtccgag
caggaagggactgaagttggtcagacgctctggttaaccactgatgttgccagacaattt
atttcgatattagaagcaggaatcgccaaaattgaatccggtgatttccaggtaaacgag
tatcggcgtcattaa |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | Not Available |
|---|
| Protein Residues: | 84 |
|---|
| Protein Molecular Weight: | 9663 |
|---|
| Protein Theoretical pI: | Not Available |
|---|
| Signaling Regions: | Not Available |
|---|
| Transmembrane Regions: | Not Available |
|---|
| Protein Sequence: | >Biofilm regulator BssS
MEKNNEVIQTHPLVGWDISTVDSYDALMLRLHYQTPNKSEQEGTEVGQTLWLTTDVARQF
ISILEAGIAKIESGDFQVNEYRRH |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | Not Available |
|---|
