Identification |
---|
Name: | Multiple stress resistance protein BhsA |
---|
Synonyms: | Not Available |
---|
Gene Name: | bhsA |
---|
Enzyme Class: | Not Available |
---|
Biological Properties |
---|
General Function: | response to copper ion |
---|
Specific Function: | Reduces the permeability of the outer membrane to copper. Seems to be involved in the regulation of biofilm formation. May decrease biofilm formation by repressing cell-cell interaction and cell surface interaction. |
---|
Cellular Location: | Not Available |
---|
SMPDB Pathways: | Not Available |
---|
KEGG Pathways: | Not Available |
---|
Metabolites: | |
---|
GO Classification: | Function |
---|
cell outer membrane | response to copper ion |
|
---|
Gene Properties |
---|
Blattner: | Not Available |
---|
Gene Orientation | Not Available |
---|
Centisome Percentage: | Not Available |
---|
Left Sequence End | Not Available |
---|
Right Sequence End | Not Available |
---|
Gene Sequence: | >258
atgaaaaacgtaaaaaccctcatcgctgcggcgattttaagctccatgtcatttgccagc
tttgcggctgtcgaagttcagtcaacgccagaaggccaacaaaaagtcggtacaatcagt
gctaacgcggggacaaatctgggatcgctggaagagcagctggcgcaaaaagcggatgag
atgggcgcaaaatctttccgtattacttctgtaaccggtccgaataccctccatggaaca
gcagtaatttataaataa |
---|
Protein Properties |
---|
Pfam Domain Function: | Not Available |
---|
Protein Residues: | 85 |
---|
Protein Molecular Weight: | 8814 |
---|
Protein Theoretical pI: | Not Available |
---|
Signaling Regions: | |
---|
Transmembrane Regions: | Not Available |
---|
Protein Sequence: | >Multiple stress resistance protein BhsA
MKNVKTLIAAAILSSMSFASFAAVEVQSTPEGQQKVGTISANAGTNLGSLEEQLAQKADE
MGAKSFRITSVTGPNTLHGTAVIYK |
---|
References |
---|
External Links: | |
---|
General Reference: | Not Available |
---|