| Identification |
|---|
| Name: | RNA polymerase-binding transcription factor DksA |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | dksA |
|---|
| Enzyme Class: | Not Available |
|---|
| Biological Properties |
|---|
| General Function: | regulation of gene expression |
|---|
| Specific Function: | Transcription factor that acts by binding directly to the RNA polymerase (RNAP). Required for negative regulation of rRNA expression and positive regulation of several amino acid biosynthesis promoters. Also required for regulation of fis expression. Binding to RNAP disrupts interaction of RNAP with DNA, inhibits formation of initiation complexes, and amplifies effects of ppGpp and the initiating NTP on rRNA transcription. Inhibits transcript elongation, exonucleolytic RNA cleavage and pyrophosphorolysis, and increases intrinsic termination. Also involved, with RecN, in repair of DNA double-strand breaks. |
|---|
| Cellular Location: | Not Available |
|---|
| SMPDB Pathways: | Not Available |
|---|
| KEGG Pathways: | Not Available |
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| cytoplasm | | regulation of gene expression | | zinc ion binding |
|
|---|
| Gene Properties |
|---|
| Blattner: | Not Available |
|---|
| Gene Orientation | Not Available |
|---|
| Centisome Percentage: | Not Available |
|---|
| Left Sequence End | Not Available |
|---|
| Right Sequence End | Not Available |
|---|
| Gene Sequence: | >456
atgcaagaagggcaaaaccgtaaaacatcgtccctgagtattctcgccatcgctggggtg
gaaccatatcaggagaagccgggcgaagagtatatgaatgaagcccagctggcgcacttc
cgtcgtattctggaagcatggcgtaatcaactcagggatgaagtcgatcgcaccgttaca
catatgcaggatgaagcagccaacttcccggacccggtagaccgtgcagcccaggaagaa
gagttcagcctcgaactgcgtaaccgcgatcgcgagcgtaagctgatcaaaaagatcgag
aagacgctgaaaaaagtggaagacgaagatttcggctactgcgaatcctgcggtgttgaa
attggtattcgccgtctggaagcgcgcccgacagccgatctgtgcatcgactgcaaaacg
ctggctgaaattcgcgaaaaacagatggctggctaa |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | Not Available |
|---|
| Protein Residues: | 151 |
|---|
| Protein Molecular Weight: | 17527 |
|---|
| Protein Theoretical pI: | Not Available |
|---|
| PDB File: | 1TJL |
| Signaling Regions: | Not Available |
|---|
| Transmembrane Regions: | Not Available |
|---|
| Protein Sequence: | >RNA polymerase-binding transcription factor DksA
MQEGQNRKTSSLSILAIAGVEPYQEKPGEEYMNEAQLAHFRRILEAWRNQLRDEVDRTVT
HMQDEAANFPDPVDRAAQEEEFSLELRNRDRERKLIKKIEKTLKKVEDEDFGYCESCGVE
IGIRRLEARPTADLCIDCKTLAEIREKQMAG |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | Not Available |
|---|
