| Identification |
|---|
| Name: | Iron-sulfur cluster insertion protein ErpA |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | erpA |
|---|
| Enzyme Class: | Not Available |
|---|
| Biological Properties |
|---|
| General Function: | protein maturation |
|---|
| Specific Function: | Probably involved in the insertion of Fe-S clusters into apoproteins in vivo including IspG and/or IspH. Essential for growth under aerobic conditions and for anaerobic respiration but not for fermentation. In vitro it binds Fe-S clusters and transfers them to apo-IspG, which is involved in quinone biosynthesis among many other cell components. Experiments indicate that it is probably also involved in the insertion of other Fe-S clusters than IspG/IspH. |
|---|
| Cellular Location: | Not Available |
|---|
| SMPDB Pathways: | Not Available |
|---|
| KEGG Pathways: | Not Available |
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| 2 iron, 2 sulfur cluster binding | | 4 iron, 4 sulfur cluster binding | | aerobic respiration | | anaerobic respiration | | iron ion binding | | iron-sulfur cluster assembly | | protein maturation | | structural molecule activity |
|
|---|
| Gene Properties |
|---|
| Blattner: | Not Available |
|---|
| Gene Orientation | Not Available |
|---|
| Centisome Percentage: | Not Available |
|---|
| Left Sequence End | Not Available |
|---|
| Right Sequence End | Not Available |
|---|
| Gene Sequence: | >345
atgagtgatgacgtagcactgccgctggagtttaccgacgcagcagccaacaaagttaaa
agcctgatcgctgacgaagataacccgaatctgaaattacgcgtgtatatcaccggtggc
ggttgcagcggcttccagtatggtttcacctttgatgatcaggtgaacgaaggcgatatg
accatcgaaaaacagggcgttggcctggtggttgatccgatgagcctgcaatatctggtc
ggcggttccgttgattataccgaaggtctggaaggttctcgtttcatcgtgaccaacccg
aacgcgaaaagcacctgcggttgcggttcttcctttagtatctaa |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | Not Available |
|---|
| Protein Residues: | 114 |
|---|
| Protein Molecular Weight: | 12100 |
|---|
| Protein Theoretical pI: | Not Available |
|---|
| Signaling Regions: | Not Available |
|---|
| Transmembrane Regions: | Not Available |
|---|
| Protein Sequence: | >Iron-sulfur cluster insertion protein ErpA
MSDDVALPLEFTDAAANKVKSLIADEDNPNLKLRVYITGGGCSGFQYGFTFDDQVNEGDM
TIEKQGVGLVVDPMSLQYLVGGSVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSI |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | Not Available |
|---|
