Identification |
---|
Name: | Hemolysin expression-modulating protein Hha |
---|
Synonyms: | Not Available |
---|
Gene Name: | hha |
---|
Enzyme Class: | Not Available |
---|
Biological Properties |
---|
General Function: | transcription, DNA-templated |
---|
Specific Function: | Down-regulates hemolysin expression, in complex with H-NS, and can also stimulate transposition events in vivo. Binds DNA and influences DNA topology in response to environmental stimuli. Involved in persister cell formation, acting downstream of mRNA interferase (toxin) MqsR. Decreases biofilm formation by repressing the transcription of fimbrial genes fimA and ihfA, and by repressing the transcription of tRNAs corresponding to rare codons, which are abundant in type 1 fimbrial genes. |
---|
Cellular Location: | Not Available |
---|
SMPDB Pathways: | Not Available |
---|
KEGG Pathways: | Not Available |
---|
Metabolites: | |
---|
GO Classification: | Function |
---|
DNA binding | regulation of gene expression | regulation of transcription, DNA-templated | transcription, DNA-templated |
|
---|
Gene Properties |
---|
Blattner: | Not Available |
---|
Gene Orientation | Not Available |
---|
Centisome Percentage: | Not Available |
---|
Left Sequence End | Not Available |
---|
Right Sequence End | Not Available |
---|
Gene Sequence: | >219
atgtccgaaaaacctttaacgaaaaccgattatttaatgcgtttacgtcgttgccagaca
attgacacgctggagcgtgttatcgagaaaaataaatacgaattatcagataatgaactg
gcggtattttactcagccgcagatcaccgcctcgccgaattgaccatgaataaactgtac
gacaagatcccttcctcagtatggaaatttattcgctaa |
---|
Protein Properties |
---|
Pfam Domain Function: | Not Available |
---|
Protein Residues: | 72 |
---|
Protein Molecular Weight: | 8627 |
---|
Protein Theoretical pI: | Not Available |
---|
PDB File: | 1JW2 |
Signaling Regions: | Not Available |
---|
Transmembrane Regions: | Not Available |
---|
Protein Sequence: | >Hemolysin expression-modulating protein Hha
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLY
DKIPSSVWKFIR |
---|
References |
---|
External Links: | |
---|
General Reference: | Not Available |
---|