Protein HokC (P0ACG4)
Identification | |||||||||
---|---|---|---|---|---|---|---|---|---|
Name: | Protein HokC | ||||||||
Synonyms: | Not Available | ||||||||
Gene Name: | hokC | ||||||||
Enzyme Class: | Not Available | ||||||||
Biological Properties | |||||||||
General Function: | plasma membrane | ||||||||
Specific Function: | When overexpressed, kills the cells from the inside by interfering with a vital function in the cell membrane. | ||||||||
Cellular Location: | Not Available | ||||||||
SMPDB Pathways: | Not Available | ||||||||
KEGG Pathways: | Not Available | ||||||||
Metabolites: |
| ||||||||
GO Classification: |
| ||||||||
Gene Properties | |||||||||
Blattner: | Not Available | ||||||||
Gene Orientation | Not Available | ||||||||
Centisome Percentage: | Not Available | ||||||||
Left Sequence End | Not Available | ||||||||
Right Sequence End | Not Available | ||||||||
Gene Sequence: | >153 atgaagcagcataaggcgatgattgtcgccctgatcgtcatctgtatcaccgccgtagtg gcggcgctggtaacgagaaaagacctctgtgaggttcacatccgaactggccagacggag gttgctgttttcacggcttacgaatccgagtaa | ||||||||
Protein Properties | |||||||||
Pfam Domain Function: | Not Available | ||||||||
Protein Residues: | 50 | ||||||||
Protein Molecular Weight: | 5501 | ||||||||
Protein Theoretical pI: | Not Available | ||||||||
Signaling Regions: | Not Available | ||||||||
Transmembrane Regions: |
| ||||||||
Protein Sequence: | >Protein HokC MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE | ||||||||
References | |||||||||
External Links: |
| ||||||||
General Reference: | Not Available |