Protein HokD (P0ACG6)
| Identification | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Name: | Protein HokD | ||||||||
| Synonyms: | Not Available | ||||||||
| Gene Name: | hokD | ||||||||
| Enzyme Class: | Not Available | ||||||||
| Biological Properties | |||||||||
| General Function: | plasma membrane | ||||||||
| Specific Function: | When overexpressed kills the cells from the inside by interfering with a vital function in the cell membrane.Overexpression of relF results in collapse of the transmembrane potential and concomitant arrest of oxygen consumption. | ||||||||
| Cellular Location: | Not Available | ||||||||
| SMPDB Pathways: | Not Available | ||||||||
| KEGG Pathways: | Not Available | ||||||||
| Metabolites: |
| ||||||||
| GO Classification: |
| ||||||||
| Gene Properties | |||||||||
| Blattner: | Not Available | ||||||||
| Gene Orientation | Not Available | ||||||||
| Centisome Percentage: | Not Available | ||||||||
| Left Sequence End | Not Available | ||||||||
| Right Sequence End | Not Available | ||||||||
| Gene Sequence: | >156 atgaagcagcaaaaggcgatgttaatcgccctgatcgtcatctgtttaaccgtcatagtg acggcactggtaacgaggaaagacctctgcgaggtacgaatccgaaccggccagacggag gtcgctgtcttcacagcttacgaacctgaggagtaa | ||||||||
| Protein Properties | |||||||||
| Pfam Domain Function: | Not Available | ||||||||
| Protein Residues: | 51 | ||||||||
| Protein Molecular Weight: | 5736 | ||||||||
| Protein Theoretical pI: | Not Available | ||||||||
| Signaling Regions: | Not Available | ||||||||
| Transmembrane Regions: |
| ||||||||
| Protein Sequence: | >Protein HokD MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE | ||||||||
| References | |||||||||
| External Links: |
| ||||||||
| General Reference: | Not Available | ||||||||