Heat shock protein 15 (P0ACG8)
Identification | |||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|
Name: | Heat shock protein 15 | ||||||||||
Synonyms: | Not Available | ||||||||||
Gene Name: | hslR | ||||||||||
Enzyme Class: | Not Available | ||||||||||
Biological Properties | |||||||||||
General Function: | response to heat | ||||||||||
Specific Function: | Involved in the recycling of free 50S ribosomal subunits that still carry a nascent chain. Binds RNA more specifically than DNA. Binds with very high affinity to the free 50S ribosomal subunit. Does not bind it when it is part of the 70S ribosome. | ||||||||||
Cellular Location: | Not Available | ||||||||||
SMPDB Pathways: | Not Available | ||||||||||
KEGG Pathways: | Not Available | ||||||||||
Metabolites: |
| ||||||||||
GO Classification: |
| ||||||||||
Gene Properties | |||||||||||
Blattner: | Not Available | ||||||||||
Gene Orientation | Not Available | ||||||||||
Centisome Percentage: | Not Available | ||||||||||
Left Sequence End | Not Available | ||||||||||
Right Sequence End | Not Available | ||||||||||
Gene Sequence: | >402 atgaaagagaaacctgctgttgaggttcgactggataaatggctatgggctgcccgtttt tataaaacccgcgcgctggcccgtgaaatgattgaaggcggtaaggtgcattacaacggg cagcgcagcaagccgagcaaaatcgtcgagctgaatgccacgctcactctgcgccaggga aatgacgaacgcacggtgattgtaaaggcgattactgaacagcgtcgccccgccagcgag gcagccttgctgtatgaagagactgcggaaagtgtagagaaacgcgaaaaaatggcgctg gcacgtaaacttaatgccttaaccatgccgcacccggaccgacgcccggacaaaaaagag cgccgcgacctgttacgatttaaacacggcgacagtgaataa | ||||||||||
Protein Properties | |||||||||||
Pfam Domain Function: | Not Available | ||||||||||
Protein Residues: | 133 | ||||||||||
Protein Molecular Weight: | 15495 | ||||||||||
Protein Theoretical pI: | Not Available | ||||||||||
PDB File: | 1DM9 | ||||||||||
Signaling Regions: | Not Available | ||||||||||
Transmembrane Regions: | Not Available | ||||||||||
Protein Sequence: | >Heat shock protein 15 MKEKPAVEVRLDKWLWAARFYKTRALAREMIEGGKVHYNGQRSKPSKIVELNATLTLRQG NDERTVIVKAITEQRRPASEAALLYEETAESVEKREKMALARKLNALTMPHPDRRPDKKE RRDLLRFKHGDSE | ||||||||||
References | |||||||||||
External Links: |
| ||||||||||
General Reference: | Not Available |