| Identification |
|---|
| Name: | cAMP-activated global transcriptional regulator CRP |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | crp |
|---|
| Enzyme Class: | Not Available |
|---|
| Biological Properties |
|---|
| General Function: | transcription, DNA-templated |
|---|
| Specific Function: | A global transcription regulator. Complexes with cyclic AMP (cAMP) which allosterically activates DNA binding (to consensus sequence 5'-AAATGTGATCTAGATCACATTT-3') to directly regulate the transcription of about 300 genes in about 200 operons and indirectly regulate the expression of about half the genome. There are 3 classes of CRP promoters; class I promoters have a single CRP-binding site upstream of the RNA polymerase (RNAP)-binding site, whereas in class II promoters the single CRP- and RNAP-binding site overlap, CRP making multiple contacts with RNAP. Class III promoters require multiple activator molecules, including at least one CRP dimer. It can act as an activator, repressor, coactivator or corepressor. Induces a severe bend in DNA (about 87 degrees), bringing upstream promoter elements into contact with RNAP. Acts as a negative regulator of its own synthesis as well as for adenylate cyclase (cyaA), which generates cAMP. High levels of active CRP are detrimental to growth (PubMed:16260780). Plays a major role in carbon catabolite repression (CCR). CCR involves cAMP, adenylate cyclase (cyaA), CRP and the EIIA-Glc component of the PTS (crr). In the presence of glucose EIIA-Glc is dephosphorylated, and does not activate adenylate cyclase, leading to reduced cAMP and thus decreased CRP activity. Also plays a role in many other processes (see PubMed:22573269). |
|---|
| Cellular Location: | Not Available |
|---|
| SMPDB Pathways: | |
|---|
| KEGG Pathways: | |
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| cAMP binding | | carbon catabolite repression of transcription | | DNA binding | | intracellular | | negative regulation of transcription, DNA-templated | | positive regulation of transcription, DNA-templated | | sequence-specific DNA binding transcription factor activity | | transcription, DNA-templated |
|
|---|
| Gene Properties |
|---|
| Blattner: | Not Available |
|---|
| Gene Orientation | Not Available |
|---|
| Centisome Percentage: | Not Available |
|---|
| Left Sequence End | Not Available |
|---|
| Right Sequence End | Not Available |
|---|
| Gene Sequence: | >633
atggtgcttggcaaaccgcaaacagacccgactctcgaatggttcttgtctcattgccac
attcataagtacccatccaagagcacgcttattcaccagggtgaaaaagcggaaacgctg
tactacatcgttaaaggctctgtggcagtgctgatcaaagacgaagagggtaaagaaatg
atcctctcctatctgaatcagggtgattttattggcgaactgggcctgtttgaagagggc
caggaacgtagcgcatgggtacgtgcgaaaaccgcctgtgaagtggctgaaatttcgtac
aaaaaatttcgccaattgattcaggtaaacccggacattctgatgcgtttgtctgcacag
atggcgcgtcgtctgcaagtcacttcagagaaagtgggcaacctggcgttcctcgacgtg
acgggccgcattgcacagactctgctgaatctggcaaaacaaccagacgctatgactcac
ccggacggtatgcaaatcaaaattacccgtcaggaaattggtcagattgtcggctgttct
cgtgaaaccgtgggacgcattctgaagatgctggaagatcagaacctgatctccgcacac
ggtaaaaccatcgtcgtttacggcactcgttaa |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | Not Available |
|---|
| Protein Residues: | 210 |
|---|
| Protein Molecular Weight: | 23640 |
|---|
| Protein Theoretical pI: | Not Available |
|---|
| PDB File: | 1CGP |
| Signaling Regions: | Not Available |
|---|
| Transmembrane Regions: | Not Available |
|---|
| Protein Sequence: | >cAMP-activated global transcriptional regulator CRP
MVLGKPQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEM
ILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQ
MARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCS
RETVGRILKMLEDQNLISAHGKTIVVYGTR |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | Not Available |
|---|
