Identification |
---|
Name: | Redox-sensitive transcriptional activator SoxR |
---|
Synonyms: | Not Available |
---|
Gene Name: | soxR |
---|
Enzyme Class: | Not Available |
---|
Biological Properties |
---|
General Function: | transcription, DNA-templated |
---|
Specific Function: | Activates the transcription of the soxS gene which itself controls the superoxide response regulon. SoxR contains a 2Fe-2S iron-sulfur cluster that may act as a redox sensor system that recognizes superoxide. The variable redox state of the Fe-S cluster is employed in vivo to modulate the transcriptional activity of SoxR in response to specific types of oxidative stress. Upon reduction of 2Fe-2S cluster, SoxR reversibly loses its transcriptional activity, but retains its DNA binding affinity. |
---|
Cellular Location: | Not Available |
---|
SMPDB Pathways: | Not Available |
---|
KEGG Pathways: | Not Available |
---|
Metabolites: | |
---|
GO Classification: | Function |
---|
2 iron, 2 sulfur cluster binding | cytoplasm | DNA binding | metal ion binding | regulation of transcription, DNA-templated | response to oxidative stress | transcription, DNA-templated |
|
---|
Gene Properties |
---|
Blattner: | Not Available |
---|
Gene Orientation | Not Available |
---|
Centisome Percentage: | Not Available |
---|
Left Sequence End | Not Available |
---|
Right Sequence End | Not Available |
---|
Gene Sequence: | >465
atggaaaagaaattaccccgcattaaagcgctgctaacccccggcgaagtggcgaaacgc
agcggtgtggcggtatcggcgctgcatttctatgaaagtaaagggttgattaccagtatc
cgtaacagcggcaatcagcggcgatataaacgtgatgtgttgcgatatgttgcaattatc
aaaattgctcagcgtattggcattccgctggcgaccattggtgaagcgtttggcgtgttg
cccgaagggcatacgttaagtgcgaaagagtggaaacagctttcgtcccaatggcgagaa
gagttggatcggcgcattcataccttagtggcgctgcgtgacgaactggacggatgtatt
ggttgtggctgcctttcgcgcagtgattgcccgttgcgtaacccgggcgaccgcttagga
gaagaaggtaccggcgcacgcttgctggaagatgaacaaaactaa |
---|
Protein Properties |
---|
Pfam Domain Function: | Not Available |
---|
Protein Residues: | 154 |
---|
Protein Molecular Weight: | 17149 |
---|
Protein Theoretical pI: | Not Available |
---|
PDB File: | 2ZHG |
Signaling Regions: | Not Available |
---|
Transmembrane Regions: | Not Available |
---|
Protein Sequence: | >Redox-sensitive transcriptional activator SoxR
MEKKLPRIKALLTPGEVAKRSGVAVSALHFYESKGLITSIRNSGNQRRYKRDVLRYVAII
KIAQRIGIPLATIGEAFGVLPEGHTLSAKEWKQLSSQWREELDRRIHTLVALRDELDGCI
GCGCLSRSDCPLRNPGDRLGEEGTGARLLEDEQN |
---|
References |
---|
External Links: | |
---|
General Reference: | Not Available |
---|