| Identification |
|---|
| Name: | Ribosome-associated inhibitor A |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | raiA |
|---|
| Enzyme Class: | Not Available |
|---|
| Biological Properties |
|---|
| General Function: | response to cold |
|---|
| Specific Function: | During stationary phase, prevents 70S dimer formation, probably in order to regulate translation efficiency during transition between the exponential and the stationary phases. In addition, during environmental stress such as cold shock or excessive cell density at stationary phase, stabilizes the 70S ribosome against dissociation, inhibits translation initiation and increase translation accuracy. When normal growth conditions are restored, is quickly released from the ribosome. Inhibits translation initiation by blocking the A-site (aminoacyl-tRNA site) and P-site (peptidyl-tRNA site) of the ribosome. Counteracts miscoding (translation errors) particularly efficiently at magnesium concentrations close to those observed in vivo but less efficiently at higher concentrations. Counteraction of miscoding was shown to be stronger than inhibition of translation, suggesting that the former activity could be the main function of RaiA in vivo. |
|---|
| Cellular Location: | Not Available |
|---|
| SMPDB Pathways: | Not Available |
|---|
| KEGG Pathways: | Not Available |
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| cytosolic small ribosomal subunit | | negative regulation of translational elongation | | negative regulation of translational initiation | | primary metabolic process | | response to cold | | ribosomal small subunit binding |
|
|---|
| Gene Properties |
|---|
| Blattner: | Not Available |
|---|
| Gene Orientation | Not Available |
|---|
| Centisome Percentage: | Not Available |
|---|
| Left Sequence End | Not Available |
|---|
| Right Sequence End | Not Available |
|---|
| Gene Sequence: | >342
atgacaatgaacattaccagcaaacaaatggaaattactccggccatccgccaacatgtc
gcagaccgtctcgccaaactggaaaaatggcaaacacatctgattaatccacatatcatt
ctgtccaaagagccacaagggtttgttgctgacgccacaatcaatacacctaacggcgtt
ctggttgccagtggtaaacatgaagatatgtacaccgcaattaacgaattgatcaacaag
ctggaacggcagctcaataaactgcagcacaaaggcgaagcacgtcgtgccgcaacatcg
gtgaaagacgccaacttcgtcgaagaagttgaagaagagtag |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | Not Available |
|---|
| Protein Residues: | 113 |
|---|
| Protein Molecular Weight: | 12784 |
|---|
| Protein Theoretical pI: | Not Available |
|---|
| PDB File: | 1L4S |
| Signaling Regions: | Not Available |
|---|
| Transmembrane Regions: | Not Available |
|---|
| Protein Sequence: | >Ribosome-associated inhibitor A
MTMNITSKQMEITPAIRQHVADRLAKLEKWQTHLINPHIILSKEPQGFVADATINTPNGV
LVASGKHEDMYTAINELINKLERQLNKLQHKGEARRAATSVKDANFVEEVEEE |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | Not Available |
|---|
