Entericidin B (P0ADB7)
| Identification | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Name: | Entericidin B | ||||||||
| Synonyms: | Not Available | ||||||||
| Gene Name: | ecnB | ||||||||
| Enzyme Class: | Not Available | ||||||||
| Biological Properties | |||||||||
| General Function: | response to toxic substance | ||||||||
| Specific Function: | Plays a role in the bacteriolysis. Is activated under conditions of high osmolarity by the factor sigma S. Entericidin A functions as an antidote. | ||||||||
| Cellular Location: | Not Available | ||||||||
| SMPDB Pathways: | Not Available | ||||||||
| KEGG Pathways: | Not Available | ||||||||
| Metabolites: |
| ||||||||
| GO Classification: |
| ||||||||
| Gene Properties | |||||||||
| Blattner: | Not Available | ||||||||
| Gene Orientation | Not Available | ||||||||
| Centisome Percentage: | Not Available | ||||||||
| Left Sequence End | Not Available | ||||||||
| Right Sequence End | Not Available | ||||||||
| Gene Sequence: | >147 atggtgaagaagacaattgcagcgatcttttctgttctggtgctttcaacagtattaact gcctgcaacaccacgcgtggcgttggtgaagacatttctgatggcggtaacgcgatttct ggcgcagcaacgaaagcgcagcaataa | ||||||||
| Protein Properties | |||||||||
| Pfam Domain Function: | Not Available | ||||||||
| Protein Residues: | 48 | ||||||||
| Protein Molecular Weight: | 4809 | ||||||||
| Protein Theoretical pI: | Not Available | ||||||||
| Signaling Regions: |
| ||||||||
| Transmembrane Regions: | Not Available | ||||||||
| Protein Sequence: | >Entericidin B MVKKTIAAIFSVLVLSTVLTACNTTRGVGEDISDGGNAISGAATKAQQ | ||||||||
| References | |||||||||
| External Links: |
| ||||||||
| General Reference: | Not Available | ||||||||