Identification |
---|
Name: | Cell division protein ZapA |
---|
Synonyms: | Not Available |
---|
Gene Name: | zapA |
---|
Enzyme Class: | Not Available |
---|
Biological Properties |
---|
General Function: | septin ring assembly |
---|
Specific Function: | Activator of cell division through the inhibition of FtsZ GTPase activity, therefore promoting FtsZ assembly into bundles of protofilaments necessary for the formation of the division Z ring. It is recruited early at mid-cell but it is not essential for cell division. |
---|
Cellular Location: | Not Available |
---|
SMPDB Pathways: | Not Available |
---|
KEGG Pathways: | Not Available |
---|
Metabolites: | |
---|
GO Classification: | Function |
---|
barrier septum assembly | cell division | cell division site | cell septum | cytoplasm | FtsZ-dependent cytokinesis | identical protein binding | plasma membrane | septin ring assembly |
|
---|
Gene Properties |
---|
Blattner: | Not Available |
---|
Gene Orientation | Not Available |
---|
Centisome Percentage: | Not Available |
---|
Left Sequence End | Not Available |
---|
Right Sequence End | Not Available |
---|
Gene Sequence: | >330
atgtctgcacaacccgtcgatatccaaatttttggccgttcactgcgtgtgaactgcccg
cctgaccaaagggatgcgttgaatcaggcagcggacgatctgaaccaacggttgcaagat
ctgaaagaacgcactagagtcacaaatactgaacagttggtcttcattgccgcattgaat
atcagctatgagttagcgcaagaaaaagcaaagactcgtgactacgcggcaagtatggaa
cagcgtattcggatgctgcagcagaccatagaacaagcgttacttgaacaaggtcgcatc
accgaaaaaactaaccaaaactttgaatga |
---|
Protein Properties |
---|
Pfam Domain Function: | Not Available |
---|
Protein Residues: | 109 |
---|
Protein Molecular Weight: | 12594 |
---|
Protein Theoretical pI: | Not Available |
---|
PDB File: | 4P1M |
Signaling Regions: | Not Available |
---|
Transmembrane Regions: | Not Available |
---|
Protein Sequence: | >Cell division protein ZapA
MSAQPVDIQIFGRSLRVNCPPDQRDALNQAADDLNQRLQDLKERTRVTNTEQLVFIAALN
ISYELAQEKAKTRDYAASMEQRIRMLQQTIEQALLEQGRITEKTNQNFE |
---|
References |
---|
External Links: | |
---|
General Reference: | Not Available |
---|