| Identification |
|---|
| Name: | Cell division activator CedA |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | cedA |
|---|
| Enzyme Class: | Not Available |
|---|
| Biological Properties |
|---|
| General Function: | regulation of cell division |
|---|
| Specific Function: | Activates the cell division inhibited by chromosomal DNA over-replication. |
|---|
| Cellular Location: | Not Available |
|---|
| SMPDB Pathways: | Not Available |
|---|
| KEGG Pathways: | Not Available |
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| cell cycle | | cell division | | DNA binding | | regulation of cell division |
|
|---|
| Gene Properties |
|---|
| Blattner: | Not Available |
|---|
| Gene Orientation | Not Available |
|---|
| Centisome Percentage: | Not Available |
|---|
| Left Sequence End | Not Available |
|---|
| Right Sequence End | Not Available |
|---|
| Gene Sequence: | >243
atgaagaaaccgctccgccagcaaaaccgccagattattagctatgtcccacgcacggaa
cccgcgccgccagaacatgcgataaagatggattcgtttcgtgatgtctggatgctgcgt
ggcaaatatgttgcgtttgtactgatgggagagtcatttctgcgctcaccggcgtttact
gtgcctgaatctgcccaacgttgggcaaatcagatccgccaggaaggggaagtgactgag
taa |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | Not Available |
|---|
| Protein Residues: | 80 |
|---|
| Protein Molecular Weight: | 9376 |
|---|
| Protein Theoretical pI: | Not Available |
|---|
| PDB File: | 2BN8 |
| Signaling Regions: | Not Available |
|---|
| Transmembrane Regions: | Not Available |
|---|
| Protein Sequence: | >Cell division activator CedA
MKKPLRQQNRQIISYVPRTEPAPPEHAIKMDSFRDVWMLRGKYVAFVLMGESFLRSPAFT
VPESAQRWANQIRQEGEVTE |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | Not Available |
|---|
