Identification |
---|
Name: | Antitoxin MazE |
---|
Synonyms: | Not Available |
---|
Gene Name: | mazE |
---|
Enzyme Class: | Not Available |
---|
Biological Properties |
---|
General Function: | transcription, DNA-templated |
---|
Specific Function: | Antitoxin component of a type II toxin-antitoxin (TA) module. Labile antitoxin that binds to the MazF endoribonuclease toxin and neutralizes its endoribonuclease activity. Is considered to be an 'addiction' molecule as the cell dies in its absence. Toxicity results when the levels of MazE decrease in the cell, leading to mRNA degradation. This effect can be rescued by expression of MazE, but after 6 hours in rich medium the overexpression of MazF leads to programmed cell death. Cell growth and viability are not affected when MazF and MazE are coexpressed. Both MazE and MazE-MazF bind to the promoter region of the mazE-mazF operon to inhibit their own transcription (PubMed:8650219). There are 3 operators to which MazE binds (PubMed:12533537). MazE has higher affinity for promoter DNA in the presence of MazF (PubMed:25564525).Cell death governed by the MazE-MazF and DinJ-YafQ TA modules seems to play a role in biofilm formation, while MazE-MazF is also implicated in cell death in liquid media.Might also serve to protect cells against bacteriophage; in the presence of MazE-MazF fewer P1 phage are produced than in a disrupted strain. For strain K38 most wild-type cells are killed but not by phage lysis; it was suggested that MazE-MazF causes P1 phage exclusion from the bacterial population. This phenomenon is strain dependent. |
---|
Cellular Location: | Not Available |
---|
SMPDB Pathways: | Not Available |
---|
KEGG Pathways: | Not Available |
---|
Metabolites: | |
---|
GO Classification: | Function |
---|
DNA binding | regulation of transcription, DNA-templated | transcription, DNA-templated |
|
---|
Gene Properties |
---|
Blattner: | Not Available |
---|
Gene Orientation | Not Available |
---|
Centisome Percentage: | Not Available |
---|
Left Sequence End | Not Available |
---|
Right Sequence End | Not Available |
---|
Gene Sequence: | >249
atgatccacagtagcgtaaagcgttggggaaattcaccggcggtgcggatcccggctacg
ttaatgcaggcgctcaatctgaatattgatgatgaagtgaagattgacctggtggatggc
aaattaattattgagccagtgcgtaaagagcccgtatttacgcttgctgaactggtcaac
gacatcacgccggaaaacctccacgagaatatcgactggggagagccgaaagataaggaa
gtctggtaa |
---|
Protein Properties |
---|
Pfam Domain Function: | Not Available |
---|
Protein Residues: | 82 |
---|
Protein Molecular Weight: | 9355 |
---|
Protein Theoretical pI: | Not Available |
---|
PDB File: | 1MVF |
Signaling Regions: | Not Available |
---|
Transmembrane Regions: | Not Available |
---|
Protein Sequence: | >Antitoxin MazE
MIHSSVKRWGNSPAVRIPATLMQALNLNIDDEVKIDLVDGKLIIEPVRKEPVFTLAELVN
DITPENLHENIDWGEPKDKEVW |
---|
References |
---|
External Links: | |
---|
General Reference: | Not Available |
---|