Identification |
---|
Name: | Ethanolamine utilization protein EutN |
---|
Synonyms: | Not Available |
---|
Gene Name: | eutN |
---|
Enzyme Class: | Not Available |
---|
Biological Properties |
---|
General Function: | ethanolamine catabolic process |
---|
Specific Function: | May be involved in the formation of a specific microcompartment in the cell in which the metabolism of potentially toxic by-products takes place. |
---|
Cellular Location: | Not Available |
---|
SMPDB Pathways: | Not Available |
---|
KEGG Pathways: | Not Available |
---|
Metabolites: | |
---|
GO Classification: | Function |
---|
cellular response to DNA damage stimulus | ethanolamine catabolic process |
|
---|
Gene Properties |
---|
Blattner: | Not Available |
---|
Gene Orientation | Not Available |
---|
Centisome Percentage: | Not Available |
---|
Left Sequence End | Not Available |
---|
Right Sequence End | Not Available |
---|
Gene Sequence: | >288
atgaaactggcagtcgtcactggacaaattgtttgtaccgtacgccatcacggactggcg
catgacaaattgctgatggtggaaatgattgatccacaaggtaatcctgacgggcaatgc
gccgtcgccatcgacaatattggcgcgggaaccggggagtgggtgttactggtgagtggc
agttccgcccgccaggcgcataaaagcgaaacgtcaccggtcgatctgtgcgtgattggc
attgtcgatgaggtggtgtctggcggtcaggtaattttccacaaataa |
---|
Protein Properties |
---|
Pfam Domain Function: | Not Available |
---|
Protein Residues: | 95 |
---|
Protein Molecular Weight: | 9956 |
---|
Protein Theoretical pI: | Not Available |
---|
PDB File: | 2HD3 |
Signaling Regions: | Not Available |
---|
Transmembrane Regions: | Not Available |
---|
Protein Sequence: | >Ethanolamine utilization protein EutN
MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSG
SSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHK |
---|
References |
---|
External Links: | |
---|
General Reference: | Not Available |
---|