Identification |
---|
Name: | Acid stress chaperone HdeA |
---|
Synonyms: | Not Available |
---|
Gene Name: | hdeA |
---|
Enzyme Class: | Not Available |
---|
Biological Properties |
---|
General Function: | cellular response to stress |
---|
Specific Function: | Required for optimal acid stress protection. Exhibits a chaperone-like activity only at pH below 3 by suppressing non-specifically the aggregation of denaturated periplasmic proteins. Important for survival of enteric bacteria in the acidic environment of the host stomach. Also promotes the solubilization at neutral pH of proteins that had aggregated in their presence at acidic pHs. May cooperate with other periplasmic chaperones such as DegP and SurA. |
---|
Cellular Location: | Not Available |
---|
SMPDB Pathways: | Not Available |
---|
KEGG Pathways: | Not Available |
---|
Metabolites: | |
---|
GO Classification: | Function |
---|
cellular response to acidic pH | cellular response to stress | chaperone binding | outer membrane-bounded periplasmic space |
|
---|
Gene Properties |
---|
Blattner: | Not Available |
---|
Gene Orientation | Not Available |
---|
Centisome Percentage: | Not Available |
---|
Left Sequence End | Not Available |
---|
Right Sequence End | Not Available |
---|
Gene Sequence: | >333
atgaaaaaagtattaggcgttattcttggtggtctgcttcttctgccagttgtgagcaat
gcagcggatgcgcaaaaagcagctgataacaaaaaaccggtcaactcctggacctgtgaa
gatttcctggctgtggacgaatccttccagccaactgcagttggttttgctgaagcgctg
aacaacaaagataaaccagaagatgcggttttagatgttcagggtattgcaaccgtaacc
ccagctatcgttcaggcttgtactcaggataaacaagccaactttaaagataaagttaaa
ggcgaatgggacaaaattaagaaagatatgtaa |
---|
Protein Properties |
---|
Pfam Domain Function: | Not Available |
---|
Protein Residues: | 110 |
---|
Protein Molecular Weight: | 11857 |
---|
Protein Theoretical pI: | Not Available |
---|
PDB File: | 1BG8 |
Signaling Regions: | |
---|
Transmembrane Regions: | Not Available |
---|
Protein Sequence: | >Acid stress chaperone HdeA
MKKVLGVILGGLLLLPVVSNAADAQKAADNKKPVNSWTCEDFLAVDESFQPTAVGFAEAL
NNKDKPEDAVLDVQGIATVTPAIVQACTQDKQANFKDKVKGEWDKIKKDM |
---|
References |
---|
External Links: | |
---|
General Reference: | Not Available |
---|