Acid stress chaperone HdeB (P0AET2)
Identification | |||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|
Name: | Acid stress chaperone HdeB | ||||||||||
Synonyms: | Not Available | ||||||||||
Gene Name: | hdeB | ||||||||||
Enzyme Class: | Not Available | ||||||||||
Biological Properties | |||||||||||
General Function: | response to pH | ||||||||||
Specific Function: | Required for optimal acid stress protection, which is important for survival of enteric bacteria in the acidic environment of the host stomach. Exhibits a chaperone-like activity at acidic pH by preventing the aggregation of many different periplasmic proteins. | ||||||||||
Cellular Location: | Not Available | ||||||||||
SMPDB Pathways: | Not Available | ||||||||||
KEGG Pathways: | Not Available | ||||||||||
Metabolites: |
| ||||||||||
GO Classification: |
| ||||||||||
Gene Properties | |||||||||||
Blattner: | Not Available | ||||||||||
Gene Orientation | Not Available | ||||||||||
Centisome Percentage: | Not Available | ||||||||||
Left Sequence End | Not Available | ||||||||||
Right Sequence End | Not Available | ||||||||||
Gene Sequence: | >327 atgaatatttcatctctccgtaaagcgtttatttttatgggcgctgtagcggctttgtca ctggtgaacgcacaatctgcgttggcagccaatgaatccgctaaagatatgacctgccag gaatttattgatctgaatccaaaagcaatgaccccggttgcatggtggatgctgcatgaa gaaacagtatataaaggtggcgataccgttactttaaatgaaaccgatctcactcaaatt cctaaagtgatcgaatactgtaagaaaaacccgcagaaaaatttgtataccttcaaaaat caagcatctaatgacttgccgaattaa | ||||||||||
Protein Properties | |||||||||||
Pfam Domain Function: | Not Available | ||||||||||
Protein Residues: | 108 | ||||||||||
Protein Molecular Weight: | 12042 | ||||||||||
Protein Theoretical pI: | Not Available | ||||||||||
PDB File: | 2XUV | ||||||||||
Signaling Regions: |
| ||||||||||
Transmembrane Regions: | Not Available | ||||||||||
Protein Sequence: | >Acid stress chaperone HdeB MNISSLRKAFIFMGAVAALSLVNAQSALAANESAKDMTCQEFIDLNPKAMTPVAWWMLHE ETVYKGGDTVTLNETDLTQIPKVIEYCKKNPQKNLYTFKNQASNDLPN | ||||||||||
References | |||||||||||
External Links: |
| ||||||||||
General Reference: | Not Available |