| Identification |
|---|
| Name: | Cell division protein ZapB |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | zapB |
|---|
| Enzyme Class: | Not Available |
|---|
| Biological Properties |
|---|
| General Function: | FtsZ-dependent cytokinesis |
|---|
| Specific Function: | Non-essential, abundant cell division factor that is required for proper Z-ring formation. It is recruited early to the divisome by direct interaction with FtsZ, stimulating Z-ring assembly and thereby promoting cell division earlier in the cell cycle. Its recruitment to the Z-ring requires functional FtsA or ZipA. |
|---|
| Cellular Location: | Not Available |
|---|
| SMPDB Pathways: | Not Available |
|---|
| KEGG Pathways: | Not Available |
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| barrier septum assembly | | cell division site | | cytoplasm | | FtsZ-dependent cytokinesis | | identical protein binding |
|
|---|
| Gene Properties |
|---|
| Blattner: | Not Available |
|---|
| Gene Orientation | Not Available |
|---|
| Centisome Percentage: | Not Available |
|---|
| Left Sequence End | Not Available |
|---|
| Right Sequence End | Not Available |
|---|
| Gene Sequence: | >246
atgacaatgtcattagaagtgtttgagaaactggaagcaaaagtacagcaggcgattgat
accatcactctgttgcagatggaaatcgaagagctgaaagaaaaaaacaactcactgtcg
caggaagttcaaaatgcccagcatcagcgcgaagagctggagcgtgagaacaaccatctg
aaagaacagcagaacggctggcaggaacgtctgcaggccctgctgggtcgcatggaagag
gtctga |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | Not Available |
|---|
| Protein Residues: | 81 |
|---|
| Protein Molecular Weight: | 9634 |
|---|
| Protein Theoretical pI: | Not Available |
|---|
| PDB File: | 2JEE |
| Signaling Regions: | Not Available |
|---|
| Transmembrane Regions: | Not Available |
|---|
| Protein Sequence: | >Cell division protein ZapB
MTMSLEVFEKLEAKVQQAIDTITLLQMEIEELKEKNNSLSQEVQNAQHQREELERENNHL
KEQQNGWQERLQALLGRMEEV |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | Not Available |
|---|
