Identification |
---|
Name: | DNA base-flipping protein |
---|
Synonyms: | Not Available |
---|
Gene Name: | atl |
---|
Enzyme Class: | Not Available |
---|
Biological Properties |
---|
General Function: | DNA dealkylation involved in DNA repair |
---|
Specific Function: | Involved in DNA damage recognition. Binds DNA containing O(6)-methylguanine and larger O(6)-alkylguanine adducts, and to double-stranded DNA that contains an AP (apurinic/apyrimidinic) site (PubMed:16027108, PubMed:18084297, PubMed:19269902, PubMed:20921378). Binds to the damaged base and flips the base out of the DNA duplex into an extrahelical conformation, which allows processing by repair proteins (PubMed:18084297). Works in partnership with the nucleotide excision repair (NER) pathway to enhance the repair of the O(6)-alkylguanine adducts larger than the methyl adduct (PubMed:19269902, PubMed:20921378). Also prevents methyl-directed mismatch repair (MMR)-mediated attack of the O(6)-alkylguanine:T mispairs for the larger alkyl groups (PubMed:20921378). |
---|
Cellular Location: | Not Available |
---|
SMPDB Pathways: | Not Available |
---|
KEGG Pathways: | Not Available |
---|
Metabolites: | |
---|
GO Classification: | Function |
---|
catalytic activity | damaged DNA binding | DNA dealkylation involved in DNA repair | enzyme binding |
|
---|
Gene Properties |
---|
Blattner: | Not Available |
---|
Gene Orientation | Not Available |
---|
Centisome Percentage: | Not Available |
---|
Left Sequence End | Not Available |
---|
Right Sequence End | Not Available |
---|
Gene Sequence: | >390
atgctggtttcttgcgcaatgcgacttcactcgggcgtttttccagattatgctgaaaaa
ttacctcaggaagaaaagatggaaaaagaagattcatttccccaacgcgtctggcaaatc
gtcgccgctattcccgaaggctatgtcaccacttacggtgatgtggcgaaactggcggga
tcgccccgcgccgcgcgccaggtgggcggtgtgttaaagcgtctccctgaaggcagcacc
ttaccctggcaccgggtggttaatcgccacggcacaatttcgctaaccggaccggattta
cagcgtcagcgacaggcattactggcagaaggtgtgatggtatcgggaagcgggcaaatc
gacttgcagcgttatcgctggaactactaa |
---|
Protein Properties |
---|
Pfam Domain Function: | Not Available |
---|
Protein Residues: | 129 |
---|
Protein Molecular Weight: | 14449 |
---|
Protein Theoretical pI: | Not Available |
---|
Signaling Regions: | Not Available |
---|
Transmembrane Regions: | Not Available |
---|
Protein Sequence: | >DNA base-flipping protein
MLVSCAMRLHSGVFPDYAEKLPQEEKMEKEDSFPQRVWQIVAAIPEGYVTTYGDVAKLAG
SPRAARQVGGVLKRLPEGSTLPWHRVVNRHGTISLTGPDLQRQRQALLAEGVMVSGSGQI
DLQRYRWNY |
---|
References |
---|
External Links: | |
---|
General Reference: | Not Available |
---|