| Identification |
|---|
| Name: | Cell division inhibitor SulA |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | sulA |
|---|
| Enzyme Class: | Not Available |
|---|
| Biological Properties |
|---|
| General Function: | SOS response |
|---|
| Specific Function: | Component of the SOS system and an inhibitor of cell division. Accumulation of SulA causes rapid cessation of cell division and the appearance of long, non-septate filaments. In the presence of GTP, binds a polymerization-competent form of FtsZ in a 1:1 ratio, thus inhibiting FtsZ polymerization and therefore preventing it from participating in the assembly of the Z ring. This mechanism prevents the premature segregation of damaged DNA to daughter cells during cell division. The effect of overexpression of SulA is neutralized by antitoxin CbeA (yeeU) (PubMed:22515815). |
|---|
| Cellular Location: | Not Available |
|---|
| SMPDB Pathways: | Not Available |
|---|
| KEGG Pathways: | Not Available |
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| barrier septum assembly | | cellular response to DNA damage stimulus | | DNA repair | | Gram-negative-bacterium-type cell wall | | negative regulation of cell division | | negative regulation of cytokinesis | | SOS response |
|
|---|
| Gene Properties |
|---|
| Blattner: | Not Available |
|---|
| Gene Orientation | Not Available |
|---|
| Centisome Percentage: | Not Available |
|---|
| Left Sequence End | Not Available |
|---|
| Right Sequence End | Not Available |
|---|
| Gene Sequence: | >510
atgtacacttcaggctatgcacatcgttcttcgtcgttctcatccgcagcaagtaaaatt
gcgcgtgtctctacggaaaacactacagccgggcttatcagtgaagttgtctatcgcgaa
gatcagcccatgatgacgcaacttctactgttgccattgttacagcaactcggtcagcaa
tcgcgctggcaactctggttaacaccgcaacaaaaactgagtcgggaatgggttcaggca
tctgggctacccttaacgaaagtaatgcagattagccagctctccccttgccacactgtg
gagtcaatggttcgcgctttacgcacgggcaattacagtgtggtgatcggttggttggca
gatgatttgactgaagaagagcatgctgaacttgttgatgcggcaaatgaaggtaacgct
atggggtttattatgcgtccggtaagcgcatcctctcacgccacgagacaactttccggg
ctaaaaattcactctaatttgtatcattaa |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | Not Available |
|---|
| Protein Residues: | 169 |
|---|
| Protein Molecular Weight: | 18801 |
|---|
| Protein Theoretical pI: | Not Available |
|---|
| Signaling Regions: | Not Available |
|---|
| Transmembrane Regions: | Not Available |
|---|
| Protein Sequence: | >Cell division inhibitor SulA
MYTSGYAHRSSSFSSAASKIARVSTENTTAGLISEVVYREDQPMMTQLLLLPLLQQLGQQ
SRWQLWLTPQQKLSREWVQASGLPLTKVMQISQLSPCHTVESMVRALRTGNYSVVIGWLA
DDLTEEEHAELVDAANEGNAMGFIMRPVSASSHATRQLSGLKIHSNLYH |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | Not Available |
|---|
