Crossover junction endodeoxyribonuclease rusA (P0AG74)

Identification
Name:Crossover junction endodeoxyribonuclease rusA
Synonyms:
  • Holliday junction nuclease rusA
  • Holliday junction resolvase
Gene Name:rusA
Enzyme Class:
Biological Properties
General Function:Involved in crossover junction endodeoxyribonuclease activity
Specific Function:Endonuclease that resolves Holliday junction intermediates made during homologous genetic recombination and DNA repair. Exhibits sequence and structure-selective cleavage of four-way DNA junctions, where it introduces symmetrical nicks in two strands of the same polarity at the 5' side of CC dinucleotides. Corrects the defects in genetic recombination and DNA repair associated with inactivation of ruvAB or ruvC
Cellular Location:Not Available
SMPDB Pathways:Not Available
KEGG Pathways:Not Available
Metabolites:
ECMDB IDNameView
GO Classification:
Function
binding
cation binding
ion binding
magnesium ion binding
metal ion binding
Process
cellular macromolecule metabolic process
DNA metabolic process
DNA recombination
DNA repair
macromolecule metabolic process
metabolic process
Gene Properties
Blattner:b0550
Gene OrientationClockwise
Centisome Percentage:12.34
Left Sequence End572594
Right Sequence End572956
Gene Sequence:
>363 bp
ATGGATTACGAATTTCTGCGCGATATTACCGGAGTGGTAAAGGTGCGTATGTCCATGGGG
CATGAAGTGGTCGGGCACTGGTTTAATGAAGAGGTGAAAGAAAACCTGGCCTTGCTTGAT
GAAGTGGAACAAGCAGCGCACGCACTGAAAGGTAGCGAACGGTCCTGGCAACGGGCAGGG
CATGAATACACCCTGTGGATGGACGGTGAAGAGGTGATGGTTCGCGCCAATCAACTGGAA
TTCGCTGGCGATGAAATGGAAGAGGGGATGAACTACTACGACGAAGAAAGCCTGTCGCTA
TGCGGCGTTGAGGATTTTCTGCAGGTCGTGGCGGCTTACCGCAATTTCGTGCAGCAGAAG
TAA
Protein Properties
Pfam Domain Function:
Protein Residues:120
Protein Molecular Weight:13846
Protein Theoretical pI:10
PDB File:1Q8R
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Crossover junction endodeoxyribonuclease rusA
MNTYSITLPWPPSNNRYYRHNRGRTHVSAEGQAYRDNVARIIKNAMLDIGLAMPVKIRIE
CHMPDRRRRDLDNLQKAAFDALTKAGFWLDDAQVVDYRVVKMPVTKGGRLELTITEMGNE
References
External Links:
ResourceLink
Uniprot ID:P0AG74
Uniprot Name:RUSA_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:21238972
PDB ID:1Q8R
Ecogene ID:EG20283
Ecocyc:EG20283
ColiBase:b0550
Kegg Gene:b0550
EchoBASE ID:EB4170
CCDB:RUSA_ECOLI
BacMap:16128533
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Bolt, E. L., Sharples, G. J., Lloyd, R. G. (1999). "Identification of three aspartic acid residues essential for catalysis by the RusA holliday junction resolvase." J Mol Biol 286:403-415. Pubmed: 9973560
  • Bolt, E. L., Sharples, G. J., Lloyd, R. G. (2000). "Analysis of conserved basic residues associated with DNA binding (Arg69) and catalysis (Lys76) by the RusA holliday junction resolvase." J Mol Biol 304:165-176. Pubmed: 11080453
  • Chan, S. N., Harris, L., Bolt, E. L., Whitby, M. C., Lloyd, R. G. (1997). "Sequence specificity and biochemical characterization of the RusA Holliday junction resolvase of Escherichia coli." J Biol Chem 272:14873-14882. Pubmed: 9169457
  • Giraud-Panis, M. J., Lilley, D. M. (1998). "Structural recognition and distortion by the DNA junction-resolving enzyme RusA." J Mol Biol 278:117-133. Pubmed: 9571038
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Macmaster, R., Sedelnikova, S., Baker, P. J., Bolt, E. L., Lloyd, R. G., Rafferty, J. B. (2006). "RusA Holliday junction resolvase: DNA complex structure--insights into selectivity and specificity." Nucleic Acids Res 34:5577-5584. Pubmed: 17028102
  • Mahdi, A. A., Sharples, G. J., Mandal, T. N., Lloyd, R. G. (1996). "Holliday junction resolvases encoded by homologous rusA genes in Escherichia coli K-12 and phage 82." J Mol Biol 257:561-573. Pubmed: 8648624
  • Rafferty, J. B., Bolt, E. L., Muranova, T. A., Sedelnikova, S. E., Leonard, P., Pasquo, A., Baker, P. J., Rice, D. W., Sharples, G. J., Lloyd, R. G. (2003). "The structure of Escherichia coli RusA endonuclease reveals a new Holliday junction DNA binding fold." Structure 11:1557-1567. Pubmed: 14656440
  • Sharples, G. J., Chan, S. N., Mahdi, A. A., Whitby, M. C., Lloyd, R. G. (1994). "Processing of intermediates in recombination and DNA repair: identification of a new endonuclease that specifically cleaves Holliday junctions." EMBO J 13:6133-6142. Pubmed: 7813450