| Identification |
|---|
| Name: | Protein-export membrane protein SecG |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | secG |
|---|
| Enzyme Class: | Not Available |
|---|
| Biological Properties |
|---|
| General Function: | protein transport by the Sec complex |
|---|
| Specific Function: | Subunit of the protein translocation channel SecYEG. Overexpression of some hybrid proteins has been thought to jam the protein secretion apparatus resulting in cell death; while this may be true it also results in FtsH-mediated degradation of SecY. Treatment with antibiotics that block translation elongation such as chloramphenicol also leads to degradation of SecY and SecE but not SecG. |
|---|
| Cellular Location: | Not Available |
|---|
| SMPDB Pathways: | Not Available |
|---|
| KEGG Pathways: | |
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| integral component of membrane | | intracellular | | intracellular protein transmembrane transport | | intracellular protein transport | | P-P-bond-hydrolysis-driven protein transmembrane transporter activity | | plasma membrane | | protein secretion | | protein transport by the Sec complex |
|
|---|
| Gene Properties |
|---|
| Blattner: | Not Available |
|---|
| Gene Orientation | Not Available |
|---|
| Centisome Percentage: | Not Available |
|---|
| Left Sequence End | Not Available |
|---|
| Right Sequence End | Not Available |
|---|
| Gene Sequence: | >333
atgtatgaagctcttttagtagttttccttattgtggcaattggccttgttggtctgatc
atgctgcagcaaggtaaaggcgctgatatgggagcctccttcggagcaggcgcttccgct
acgctgtttggttcaagtggttctggtaacttcatgacccgcatgacggcgctgctggca
acgttattcttcatcatcagtctggtgctgggtaacatcaatagcaacaaaaccaataaa
ggtagcgaatgggaaaatctgagtgcaccggcgaaaaccgaacaaactcagccagctgct
ccggctaagccgaccagcgatatcccgaactaa |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | Not Available |
|---|
| Protein Residues: | 110 |
|---|
| Protein Molecular Weight: | 11365 |
|---|
| Protein Theoretical pI: | Not Available |
|---|
| PDB File: | 2AKH |
| Signaling Regions: | Not Available |
|---|
| Transmembrane Regions: | |
|---|
| Protein Sequence: | >Protein-export membrane protein SecG
MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLA
TLFFIISLVLGNINSNKTNKGSEWENLSAPAKTEQTQPAAPAKPTSDIPN |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | Not Available |
|---|
