| Identification |
|---|
| Name: | mRNA interferase RelE |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | relE |
|---|
| Enzyme Class: | Not Available |
|---|
| Biological Properties |
|---|
| General Function: | transcription, DNA-templated |
|---|
| Specific Function: | Toxic component of a type II toxin-antitoxin (TA) module (PubMed:9767574). A sequence-specific, ribosome-dependent mRNA endoribonuclease that inhibits translation during amino acid starvation (the stringent response). In vitro acts by cleaving mRNA with high codon specificity in the ribosomal A site between positions 2 and 3. The stop codon UAG is cleaved at a fast rate while UAA and UGA are cleaved with intermediate and slow rates. In vitro mRNA cleavage can also occur in the ribosomal E site after peptide release from peptidyl-tRNA in the P site as well as on free 30S subunits (PubMed:12526800). In vivo cuts frequently in the first 100 codons, most frequently after the second and third base and rarely near the stop codon (PubMed:21324908). Overexpression of RelE results in the inhibition of bacterial growth and a sharp decrease in colony-forming ability which is neutralized by the labile cognate antitoxin RelB. Overexpression also sharply increases persisters (cells that neither grow nor die in the presence of bactericidal agents and are largely responsible for high levels of biofilm tolerance to antimicrobials) (PubMed:15576765). Plays a role in dormancy when expressed in high-density cells in the absence of antitoxin RelB; amino acid starvation and an unidentified extracellular factor promote dormancy, while expression of antitoxin RelB restores cell culturability (PubMed:22210768). Acts with RelB as a corepressor of relBE transcription, considerably increasing the repression of RelB alone. 2 RelB dimers bind to 2 operator sequences; DNA-binding and repression is stronger when complexed with toxin/corepressor RelE by conditional cooperativity (PubMed:9767574, PubMed:19747491, PubMed:18501926, PubMed:22981948).Seems to be a principal mediator of cell death in liquid media (PubMed:19707553). Implicated in hydroxy radical-mediated cell death induced by hydroxyurea treatment (PubMed:20005847).Cross-talk can occur between different TA modules. Ectopic expression of this toxin induces transcription of 7 tested TA modules (dinJ/yafQ, hicAB, mazEF, mqsRA, prlF(sohA)/yhaV, relBEF and yefM/yoeB) with specific cleavage of the relBEF mRNA produced immediately upstream and within the relB coding sequence. The cleaved mRNA can be translated into RelE, leading to a positive feedback cycle of RelE expression. The relBEF operon is required for transcription of the mazEF TA module operon during amino acid starvation. |
|---|
| Cellular Location: | Not Available |
|---|
| SMPDB Pathways: | Not Available |
|---|
| KEGG Pathways: | Not Available |
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| cellular response to amino acid starvation | | endoribonuclease activity | | mRNA catabolic process | | negative regulation of translation | | regulation of transcription, DNA-templated | | response to antibiotic | | ribosome binding | | RNA phosphodiester bond hydrolysis, endonucleolytic | | rRNA binding | | transcription, DNA-templated |
|
|---|
| Gene Properties |
|---|
| Blattner: | Not Available |
|---|
| Gene Orientation | Not Available |
|---|
| Centisome Percentage: | Not Available |
|---|
| Left Sequence End | Not Available |
|---|
| Right Sequence End | Not Available |
|---|
| Gene Sequence: | >288
atggcgtattttctggattttgacgagcgggcactaaaggaatggcgaaagctgggctcg
acggtacgtgaacagttgaaaaagaagctggttgaagtacttgagtcaccccggattgaa
gcaaacaagctccgtggtatgcctgattgttacaagattaagctccggtcttcaggctat
cgccttgtataccaggttatagacgagaaagttgtcgttttcgtgatttctgttgggaaa
agagaacgctcggaagtatatagcgaggcggtcaaacgcattctctga |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | Not Available |
|---|
| Protein Residues: | 95 |
|---|
| Protein Molecular Weight: | 11225 |
|---|
| Protein Theoretical pI: | Not Available |
|---|
| PDB File: | 2KC8 |
| Signaling Regions: | Not Available |
|---|
| Transmembrane Regions: | Not Available |
|---|
| Protein Sequence: | >mRNA interferase RelE
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGY
RLVYQVIDEKVVVFVISVGKRERSEVYSEAVKRIL |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | Not Available |
|---|
