| Identification |
|---|
| Name: | Antitoxin RelB |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | relB |
|---|
| Enzyme Class: | Not Available |
|---|
| Biological Properties |
|---|
| General Function: | transcription, DNA-templated |
|---|
| Specific Function: | Antitoxin component of a type II toxin-antitoxin (TA) module. Counteracts the effect of cognate toxin RelE via direct protein-protein interaction, preventing RelE from entering the ribosome A site and thus inhibiting its endoribonuclease activity. An autorepressor of relBE operon transcription. 2 RelB dimers bind to 2 operator sequences; DNA-binding and repression is stronger when complexed with toxin/corepressor RelE by conditional cooperativity (PubMed:18501926, PubMed:22981948). Increased transcription rate of relBE and activation of relE is consistent with a lower level of RelB in starved cells due to degradation of RelB by protease Lon.Seems to be a principal mediator of cell death in liquid media. |
|---|
| Cellular Location: | Not Available |
|---|
| SMPDB Pathways: | Not Available |
|---|
| KEGG Pathways: | Not Available |
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| DNA binding | | regulation of transcription, DNA-templated | | transcription, DNA-templated |
|
|---|
| Gene Properties |
|---|
| Blattner: | Not Available |
|---|
| Gene Orientation | Not Available |
|---|
| Centisome Percentage: | Not Available |
|---|
| Left Sequence End | Not Available |
|---|
| Right Sequence End | Not Available |
|---|
| Gene Sequence: | >240
atgggtagcattaacctgcgtattgacgatgaacttaaagcgcgttcttacgccgcgctt
gaaaaaatgggtgtaactccttctgaagcgcttcgtctcatgctcgagtatatcgctgac
aatgaacgcttgccgttcaaacagacactcctgagtgatgaagatgctgaacttgtggag
atagtgaaagaacggcttcgtaatcctaagccagtacgtgtgacgctggatgaactctga
|
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | Not Available |
|---|
| Protein Residues: | 79 |
|---|
| Protein Molecular Weight: | 9071 |
|---|
| Protein Theoretical pI: | Not Available |
|---|
| PDB File: | 2K29 |
| Signaling Regions: | Not Available |
|---|
| Transmembrane Regions: | Not Available |
|---|
| Protein Sequence: | >Antitoxin RelB
MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVE
IVKERLRNPKPVRVTLDEL |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | Not Available |
|---|
