Identification |
---|
Name: | Glycogen synthesis protein GlgS |
---|
Synonyms: | Not Available |
---|
Gene Name: | glgS |
---|
Enzyme Class: | Not Available |
---|
Biological Properties |
---|
General Function: | positive regulation of cellular carbohydrate metabolic process |
---|
Specific Function: | Involved in glycogen synthesis. May be involved in glycogen priming. |
---|
Cellular Location: | Not Available |
---|
SMPDB Pathways: | Not Available |
---|
KEGG Pathways: | Not Available |
---|
Metabolites: | |
---|
GO Classification: | Function |
---|
glycogen biosynthetic process | negative regulation of bacterial-type flagellum-dependent cell motility | negative regulation of single-species biofilm formation on inanimate substrate | positive regulation of cellular carbohydrate metabolic process |
|
---|
Gene Properties |
---|
Blattner: | Not Available |
---|
Gene Orientation | Not Available |
---|
Centisome Percentage: | Not Available |
---|
Left Sequence End | Not Available |
---|
Right Sequence End | Not Available |
---|
Gene Sequence: | >201
atggatcatagtcttaattctttaaataatttcgatttcctggcgcgtagttttgccaga
atgcacgcagaaggtcgcccggtcgatattctggccgttactggtaacatggatgaagaa
catagaacctggttttgcgcacgttatgcctggtattgtcaacagatgatgcaggcaaga
gagctggagttagagcactga |
---|
Protein Properties |
---|
Pfam Domain Function: | Not Available |
---|
Protein Residues: | 66 |
---|
Protein Molecular Weight: | 7891 |
---|
Protein Theoretical pI: | Not Available |
---|
PDB File: | 1RRZ |
Signaling Regions: | Not Available |
---|
Transmembrane Regions: | Not Available |
---|
Protein Sequence: | >Glycogen synthesis protein GlgS
MDHSLNSLNNFDFLARSFARMHAEGRPVDILAVTGNMDEEHRTWFCARYAWYCQQMMQAR
ELELEH |
---|
References |
---|
External Links: | |
---|
General Reference: | Not Available |
---|