| Identification |
|---|
| Name: | Transcription elongation factor GreB |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | greB |
|---|
| Enzyme Class: | Not Available |
|---|
| Biological Properties |
|---|
| General Function: | regulation of DNA-templated transcription, elongation |
|---|
| Specific Function: | Necessary for efficient RNA polymerase transcription elongation past template-encoded arresting sites. The arresting sites in DNA have the property of trapping a certain fraction of elongating RNA polymerases that pass through, resulting in locked ternary complexes. Cleavage of the nascent transcript by cleavage factors such as GreA or GreB allows the resumption of elongation from the new 3'terminus. GreB releases sequences of up to 9 nucleotides in length. |
|---|
| Cellular Location: | Not Available |
|---|
| SMPDB Pathways: | Not Available |
|---|
| KEGG Pathways: | Not Available |
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| DNA binding | | DNA-templated transcription, initiation | | positive regulation of mRNA cleavage | | regulation of DNA-templated transcription, elongation |
|
|---|
| Gene Properties |
|---|
| Blattner: | Not Available |
|---|
| Gene Orientation | Not Available |
|---|
| Centisome Percentage: | Not Available |
|---|
| Left Sequence End | Not Available |
|---|
| Right Sequence End | Not Available |
|---|
| Gene Sequence: | >477
atgaaaacgcccctggttacccgggaagggtatgaaaaactcaaacaagagcttaattat
ctctggcgtgaagaacgcccggaggtcacaaaaaaggtgacctgggccgcaagtctgggc
gaccgcagcgaaaatgctgactatcagtataataaaaagcgtctgcgtgaaatcgaccgt
cgcgtgcgctatctcactaaatgcctggaaaatctcaaaatcgtcgattactcccctcag
caggaaggcaaagtcttttttggcgcgtgggtggagattgaaaacgacgatggcgtgact
caccgtttccgtattgtcggctacgatgaaatttttggccgtaaagattacatctctatc
gattccccgatggcccgcgcattgctgaaaaaagaagtcggcgatctggcggtggtgaat
acccctgccggggaagcgagctggtatgttaatgctatcgagtacgtgaaaccgtaa |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | Not Available |
|---|
| Protein Residues: | 158 |
|---|
| Protein Molecular Weight: | 18526 |
|---|
| Protein Theoretical pI: | Not Available |
|---|
| PDB File: | 2P4V |
| Signaling Regions: | Not Available |
|---|
| Transmembrane Regions: | Not Available |
|---|
| Protein Sequence: | >Transcription elongation factor GreB
MKTPLVTREGYEKLKQELNYLWREERPEVTKKVTWAASLGDRSENADYQYNKKRLREIDR
RVRYLTKCLENLKIVDYSPQQEGKVFFGAWVEIENDDGVTHRFRIVGYDEIFGRKDYISI
DSPMARALLKKEVGDLAVVNTPAGEASWYVNAIEYVKP |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | Not Available |
|---|
