| Identification |
|---|
| Name: | Endoribonuclease ChpB |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | chpB |
|---|
| Enzyme Class: | Not Available |
|---|
| Biological Properties |
|---|
| General Function: | RNA phosphodiester bond hydrolysis, endonucleolytic |
|---|
| Specific Function: | Toxic component of a type II toxin-antitoxin (TA) module. ChpB is a sequence-specific mRNA and (weak) tmRNA endoribonuclease that inhibits protein synthesis and induces bacterial stasis. Cleavage is independent of the ribosome. Cleavage occurs at ACY sequences where Y is not C. The endoribonuclease activity is not as strong as that of MazF. The endoribonuclease activity (a toxin) is inhibited by its labile cognate antitoxin ChpS. Toxicity results when the levels of ChpS decrease in the cell, leading to mRNA degradation. Both ChpS and ChpB probably bind to the promoter region of the chpS-chpB operon to autoregulate their synthesis. |
|---|
| Cellular Location: | Not Available |
|---|
| SMPDB Pathways: | Not Available |
|---|
| KEGG Pathways: | Not Available |
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| DNA binding | | endoribonuclease activity | | endoribonuclease activity, producing 5'-phosphomonoesters | | negative regulation of cell growth | | regulation of mRNA stability | | RNA binding | | RNA phosphodiester bond hydrolysis, endonucleolytic |
|
|---|
| Gene Properties |
|---|
| Blattner: | Not Available |
|---|
| Gene Orientation | Not Available |
|---|
| Centisome Percentage: | Not Available |
|---|
| Left Sequence End | Not Available |
|---|
| Right Sequence End | Not Available |
|---|
| Gene Sequence: | >351
atggtaaagaaaagtgaatttgaacggggagacattgtgctggttggctttgatccagca
agcggccatgaacagcaaggtgctggtcgacctgcgcttgtgctctccgttcaagccttt
aatcaactgggaatgacgctggtggcccccattacgcagggcggaaattttgcccgttat
gccggatttagcgttcctttacattgcgaagaaggcgatgtgcacggcgtggtgctggtg
aatcaggtgcggatgatggatctacacgcccggctggcaaagcgtattggtctggctgcg
gatgaggtggtggaagaggcgttattacgcttgcaggcggtggtggaataa |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | Not Available |
|---|
| Protein Residues: | 116 |
|---|
| Protein Molecular Weight: | 12492 |
|---|
| Protein Theoretical pI: | Not Available |
|---|
| Signaling Regions: | Not Available |
|---|
| Transmembrane Regions: | Not Available |
|---|
| Protein Sequence: | >Endoribonuclease ChpB
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARY
AGFSVPLHCEEGDVHGVVLVNQVRMMDLHARLAKRIGLAADEVVEEALLRLQAVVE |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | Not Available |
|---|
