Acid shock protein (P36560)
Identification | |||||||||
---|---|---|---|---|---|---|---|---|---|
Name: | Acid shock protein | ||||||||
Synonyms: | Not Available | ||||||||
Gene Name: | asr | ||||||||
Enzyme Class: | Not Available | ||||||||
Biological Properties | |||||||||
General Function: | response to zinc ion | ||||||||
Specific Function: | Required for growth and/or survival at acidic conditions (pH 4.5). Needed for the adaptation process at pH 4.5 that enables cells to survive at extremely low pH (pH 2.0). | ||||||||
Cellular Location: | Not Available | ||||||||
SMPDB Pathways: | Not Available | ||||||||
KEGG Pathways: | Not Available | ||||||||
Metabolites: |
| ||||||||
GO Classification: |
| ||||||||
Gene Properties | |||||||||
Blattner: | Not Available | ||||||||
Gene Orientation | Not Available | ||||||||
Centisome Percentage: | Not Available | ||||||||
Left Sequence End | Not Available | ||||||||
Right Sequence End | Not Available | ||||||||
Gene Sequence: | >309 atgaaaaaagtattagctctggttgttgccgctgctatgggtctgtcttctgccgccttt gctgcagagactacgaccacacctgctccgactgcgacgaccaccaaagcagcgccggcg aaaactacacatcataaaaaacagcataaagcagcacctgcccagaaagcgcaggcggct aaaaagcatcataaaaatacgaaagctgaacagaaagcccctgaacaaaaagcgcaggca gcgaagaaacacgccaagaaacacagccatcagcaaccggcaaaacctgctgcacaaccc gcagcgtaa | ||||||||
Protein Properties | |||||||||
Pfam Domain Function: | Not Available | ||||||||
Protein Residues: | 102 | ||||||||
Protein Molecular Weight: | 10591 | ||||||||
Protein Theoretical pI: | Not Available | ||||||||
Signaling Regions: |
| ||||||||
Transmembrane Regions: | Not Available | ||||||||
Protein Sequence: | >Acid shock protein MKKVLALVVAAAMGLSSAAFAAETTTTPAPTATTTKAAPAKTTHHKKQHKAAPAQKAQAA KKHHKNTKAEQKAPEQKAQAAKKHAKKHSHQQPAKPAAQPAA | ||||||||
References | |||||||||
External Links: |
| ||||||||
General Reference: | Not Available |