Identification |
---|
Name: | Arsenical resistance operon repressor |
---|
Synonyms: | Not Available |
---|
Gene Name: | arsR |
---|
Enzyme Class: | Not Available |
---|
Biological Properties |
---|
General Function: | transcription, DNA-templated |
---|
Specific Function: | Transcriptional repressor for the arsEFG operon. ArsE is a trans-acting regulatory protein which controls its own expression. The repressive effect of ArsE is alleviated by oxyions of +III oxidation state of arsenic, antimony, and bismuth, as well as arsenate (As(V)) (By similarity). |
---|
Cellular Location: | Not Available |
---|
SMPDB Pathways: | Not Available |
---|
KEGG Pathways: | Not Available |
---|
Metabolites: | |
---|
GO Classification: | Function |
---|
DNA binding | intracellular | regulation of transcription, DNA-templated | response to arsenic-containing substance | sequence-specific DNA binding transcription factor activity | transcription, DNA-templated |
|
---|
Gene Properties |
---|
Blattner: | Not Available |
---|
Gene Orientation | Not Available |
---|
Centisome Percentage: | Not Available |
---|
Left Sequence End | Not Available |
---|
Right Sequence End | Not Available |
---|
Gene Sequence: | >354
atgtcatttctgttacccatccaattgttcaaaattcttgctgatgaaacccgtctgggc
atcgttttactgctcagcgaactgggagagttatgcgtctgcgatctctgcactgctctc
gaccagtcgcagcccaagatctcccgccacctggcattgctgcgtgaaagcgggctattg
ctggaccgcaagcaaggtaagtgggttcattaccgcttatcaccgcatattccagcatgg
gcggcgaaaattattgatgaggcctggcgatgtgaacaggaaaaggttcaggcgattgtc
cgcaacctggctcgacaaaactgttccggggacagtaagaacatttgcagttaa |
---|
Protein Properties |
---|
Pfam Domain Function: | Not Available |
---|
Protein Residues: | 117 |
---|
Protein Molecular Weight: | 13252 |
---|
Protein Theoretical pI: | Not Available |
---|
Signaling Regions: | Not Available |
---|
Transmembrane Regions: | Not Available |
---|
Protein Sequence: | >Arsenical resistance operon repressor
MSFLLPIQLFKILADETRLGIVLLLSELGELCVCDLCTALDQSQPKISRHLALLRESGLL
LDRKQGKWVHYRLSPHIPAWAAKIIDEAWRCEQEKVQAIVRNLARQNCSGDSKNICS |
---|
References |
---|
External Links: | |
---|
General Reference: | Not Available |
---|